DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN and DSC1

DIOPT Version :9

Sequence 1:NP_001027277.1 Gene:CadN / 35070 FlyBaseID:FBgn0015609 Length:3101 Species:Drosophila melanogaster
Sequence 2:NP_077739.1 Gene:DSC1 / 1823 HGNCID:3035 Length:894 Species:Homo sapiens


Alignment Length:710 Identity:201/710 - (28%)
Similarity:298/710 - (41%) Gaps:165/710 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1471 GAIYVAGAL--------------DYETRRRYELRLAASDNLKENYTTVIIHVKDVNDNPPVFERP 1521
            |:||....|              |.:.|.:.|:::..|  .:||.:....|.||.     ..:|.
Human    75 GSIYTTHDLILSSERKSFSIFLSDGQRREQQEIKVVLS--ARENKSPKKRHTKDT-----ALKRS 132

  Fly  1522 TYR-----TQITEEDDRNLPKRVLQVTATDGDKDRPQN--IVYFLTGQGIDPDNPANSKFDINRT 1579
            ..|     ..:.|......|:.|.|:     ..|..||  |.|.::|.|:|.: |.| .|.|.:.
Human   133 KRRWAPIPASLMENSLGPFPQHVQQI-----QSDAAQNYTIFYSISGPGVDKE-PFN-LFYIEKD 190

  Fly  1580 TGEIFVLKPLDRDQPNGRPQWRFTVFAQDEGGEGLVGYADVQ------------VNLKDINDNAP 1632
            ||:||..:.:||:        ::..||       |.|||...            :.::|.|||||
Human   191 TGDIFCTRSIDRE--------KYEQFA-------LYGYATTADGYAPEYPLPLIIKIEDDNDNAP 240

  Fly  1633 IFPQGVYFGNVTENGTAGMVVMTMTAVDYDDPNEGSNARLVYSIEKNVIEEETGSPIFEIEPDTG 1697
            .|...|....|.||..:|..|..:||.|.|:| :..:.||.|.|.:.:.:....   |.|.||||
Human   241 YFEHRVTIFTVPENCRSGTSVGKVTATDLDEP-DTLHTRLKYKILQQIPDHPKH---FSIHPDTG 301

  Fly  1698 VIKTAVCCLDRERTPDYSIQVVAMDGG----GLKGTGTASIRVKDINDMPPQFTKDEWFTEVDET 1758
            ||.|....||||:...|.:.:...|.|    ||..|||.:|.::|.||.||.||:..:.|||:|.
Human   302 VITTTTPFLDREKCDTYQLIMEVRDMGGQPFGLFNTGTITISLEDENDNPPSFTETSYVTEVEEN 366

  Fly  1759 DGTALPEMPILTVTVHDEDETN----KFQYKVIDNSGYGADKFTMVRN-NDGTGSLKIVQPLDYE 1818
                ..::.||.:.|.|:|..|    |..||::..:..|  .|.:..: |...|.|.:|:||:||
Human   367 ----RIDVEILRMKVQDQDLPNTPHSKAVYKILQGNENG--NFIISTDPNTNEGVLCVVKPLNYE 425

  Fly  1819 DQLQSNGFRFRIQVNDKGEDNDNDKYHVAYS--------WVVVKLRDINDNKPHFERANVEVSVF 1875
            ...|     ..:||   |..|:......|.|        .|.||:.| :|..|........:...
Human   426 VNRQ-----VILQV---GVINEAQFSKAASSQTPTMCTTTVTVKIID-SDEGPECHPPVKVIQSQ 481

  Fly  1876 EDTKVGTELEKFKATDPDQGGKSKVSYSIDRSSDRQRQFAINQN-GSVTIQRSLDRE--VVPRHQ 1937
            :....|.||..:||.||:......:.|  .:..|....|.|||: |.:...:.||||  .|..:|
Human   482 DGFPAGQELLGYKALDPEISSGEGLRY--QKLGDEDNWFEINQHTGDLRTLKVLDRESKFVKNNQ 544

  Fly  1938 --VKILAIDDGSPPKTATATLTVIVQDINDNAPKFLKD------------YRPVLPEHVPPRKVV 1988
              :.::|:|  :..::.|.||.|.:.|.||:||:..|:            .:||.|:        
Human   545 YNISVVAVD--AVGRSCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPD-------- 599

  Fly  1989 EILATDDDDRSKSNGPPFQFRLDPSADDIIRASFKVEQDQKGANGDGMAVISSLRSFDREQQKEY 2053
                      ...|||||||.||.||.    .::.:|:.      ||...|  ||.........|
Human   600 ----------GPENGPPFQFFLDNSAS----KNWNIEEK------DGKTAI--LRQRQNLDYNYY 642

  Fly  2054 MIPIVIKD-HGSPAMTGTSTLTVIIGDV---NDNKMQPGS-KDIFVYNYQGQSPDTPIGR 2108
            .:||.||| ||   :..|..|||.:.|.   ::.:|:..| :|:        .|:..:||
Human   643 SVPIQIKDRHG---LVATHMLTVRVCDCSTPSECRMKDKSTRDV--------RPNVILGR 691

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadNNP_001027277.1 Cadherin_repeat 178..301 CDD:206637
Cadherin_repeat 337..396 CDD:206637
E_set 449..541 CDD:298831
Cadherin_repeat 549..>625 CDD:206637
Cadherin_repeat 655..752 CDD:206637
Cadherin_repeat 765..853 CDD:206637
Cadherin_repeat 862..964 CDD:206637
Cadherin_repeat 973..1074 CDD:206637
Cadherin_repeat 1083..1166 CDD:206637
Cadherin_repeat <1219..1298 CDD:206637
Cadherin_repeat 1310..1414 CDD:206637
Cadherin_repeat 1423..1514 CDD:206637 13/56 (23%)
Cadherin_repeat 1522..1630 CDD:206637 31/126 (25%)
Cadherin_repeat 1638..1741 CDD:206637 38/106 (36%)
Cadherin_repeat 1762..1861 CDD:206637 30/111 (27%)
Cadherin_repeat 1871..1966 CDD:206637 28/99 (28%)
Cadherin_repeat 1974..2083 CDD:206637 33/112 (29%)
EGF 2350..2380 CDD:278437
LamG 2385..2570 CDD:238058
EGF_2 <2605..2631 CDD:285248
Laminin_G_2 2665..2800 CDD:280389
EGF_CA 2869..2907 CDD:238011
Cadherin_C 2952..3088 CDD:279398
DSC1NP_077739.1 Cadherin_pro 29..109 CDD:214999 7/33 (21%)
Cadherin 139..233 CDD:278457 28/115 (24%)
Cadherin_repeat 249..350 CDD:206637 38/104 (37%)
Cadherin 359..449 CDD:278457 29/103 (28%)
Cadherin_repeat 485..573 CDD:206637 28/91 (31%)
E_set 596..667 CDD:298831 31/103 (30%)
Cadherin_C <850..888 CDD:279398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9605
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.