DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN and DSG4

DIOPT Version :9

Sequence 1:NP_001027277.1 Gene:CadN / 35070 FlyBaseID:FBgn0015609 Length:3101 Species:Drosophila melanogaster
Sequence 2:NP_001127925.1 Gene:DSG4 / 147409 HGNCID:21307 Length:1059 Species:Homo sapiens


Alignment Length:641 Identity:172/641 - (26%)
Similarity:280/641 - (43%) Gaps:98/641 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1505 IIHVKDVNDNPPVFERPTYRTQITE---------EDDRNLPKRVLQVTATDGDKDRPQNIVYFLT 1560
            |:.||:.:......:..|.|.|..|         |.:.|..:..:....:|.:.:  |.|.|.::
Human    26 IVEVKEFDIENGTTKWQTVRRQKREWIKFAAACREGEDNSKRNPIAKIRSDCESN--QKITYRIS 88

  Fly  1561 GQGIDPDNPANSKFDINRTTGEIFVLKPLDRDQPNGRPQWRFTVFAQDEGGEGLVGYADVQVNLK 1625
            |.||  |.|....|.||..||||.:...:||:.   .|.:.....|.:..||.|....:::|.:.
Human    89 GVGI--DRPPYGVFTINPRTGEINITSVVDREI---TPLFLIYCRALNSRGEDLERPLELRVKVM 148

  Fly  1626 DINDNAPIFPQGVYFGNVTENGTAGMVVMTMTAVDYDDPNEGSNARLVYSIEKNVIEEETGSPIF 1690
            |||||||:|.|.||..::.||..|..:|:.:.|.|.|:.|. .|:::.|.|   |.:|.:|:|:|
Human   149 DINDNAPVFSQSVYTASIEENSDANTLVVKLCATDADEENH-LNSKIAYKI---VSQEPSGAPMF 209

  Fly  1691 EIEPDTGVIKTAVCCLDRERTPDYSIQVVAMD----GGGLKGTGTASIRVKDINDMPPQFTKDEW 1751
            .:...||.:.|....||||:...|::.|...|    ..||.......|:|.|:||..|...|..:
Human   210 ILNRYTGEVCTMSSFLDREQHSMYNLVVRGSDRDGAADGLSSECDCRIKVLDVNDNFPTLEKTSY 274

  Fly  1752 FTEVDETDGTALPEMPILTVTVHDEDETNKF--QYKVID-NSGYGADKFTMVRNNDGTGSLKIVQ 1813
            ...::|  .....|:..|.....||:.|:.:  ||.::. |.|...|..|..:.|:|.  ||:|:
Human   275 SASIEE--NCLSSELIRLQAIDLDEEGTDNWLAQYLILSGNDGNWFDIQTDPQTNEGI--LKVVK 335

  Fly  1814 PLDYEDQLQSNGFRFRIQVNDKGEDNDNDKYHVAYSW------VVVKLRDINDNKPHFERANVEV 1872
            .||||   |:...:..|.|.::.:.:    |.||..:      |.:::.|:.:. |.|..:.:..
Human   336 MLDYE---QAPNIQLSIGVKNQADFH----YSVASQFQMHPTPVRIQVVDVREG-PAFHPSTMAF 392

  Fly  1873 SVFEDTK--------VGTELEKFKATDPDQGG-KSKVSYSIDRSSDRQRQFAINQNGSVTIQRSL 1928
            ||.|..|        :||    :.|.|.|.|. .:.|.|.|...:....:.. ::.|.:...|..
Human   393 SVREGIKGSSLLNYVLGT----YTAIDLDTGNPATDVRYIIGHDAGSWLKID-SRTGEIQFSREF 452

  Fly  1929 DRE----VVPRHQVKILAIDDGSPPKTATATLTVIVQDINDNAPKFLKDYRPVLPEHVPPRKVVE 1989
            |::    :...:..:|||||||| .||||.|:.:.|.||||..|....:.|.:..:  .|..::.
Human   453 DKKSKYIINGIYTAEILAIDDGS-GKTATGTICIEVPDINDYCPNIFPERRTICID--SPSVLIS 514

  Fly  1990 ILATDDDDRSKSNGPPFQFRL---DPSADDIIRASFKVEQDQKGANGDGMAVISSLR----SFDR 2047
            :       ...|.|.||.|.:   .|...|:        .|.:..|... |::::.:    .|  
Human   515 V-------NEHSYGSPFTFCVVDEPPGIADM--------WDVRSTNATS-AILTAKQVLSPGF-- 561

  Fly  2048 EQQKEYMIPIVIKDHGSPAMTGTSTLTVIIGDVNDNKM--QPGSKDIFVYNYQGQS 2101
                 |.|||::||..:.|......:.:...|.:||.|  ..|:..|:..:..|.:
Human   562 -----YEIPILVKDSYNRACELAQMVQLYACDCDDNHMCLDSGAAGIYTEDITGDT 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadNNP_001027277.1 Cadherin_repeat 178..301 CDD:206637
Cadherin_repeat 337..396 CDD:206637
E_set 449..541 CDD:298831
Cadherin_repeat 549..>625 CDD:206637
Cadherin_repeat 655..752 CDD:206637
Cadherin_repeat 765..853 CDD:206637
Cadherin_repeat 862..964 CDD:206637
Cadherin_repeat 973..1074 CDD:206637
Cadherin_repeat 1083..1166 CDD:206637
Cadherin_repeat <1219..1298 CDD:206637
Cadherin_repeat 1310..1414 CDD:206637
Cadherin_repeat 1423..1514 CDD:206637 3/8 (38%)
Cadherin_repeat 1522..1630 CDD:206637 33/116 (28%)
Cadherin_repeat 1638..1741 CDD:206637 33/106 (31%)
Cadherin_repeat 1762..1861 CDD:206637 28/107 (26%)
Cadherin_repeat 1871..1966 CDD:206637 33/107 (31%)
Cadherin_repeat 1974..2083 CDD:206637 21/115 (18%)
EGF 2350..2380 CDD:278437
LamG 2385..2570 CDD:238058
EGF_2 <2605..2631 CDD:285248
Laminin_G_2 2665..2800 CDD:280389
EGF_CA 2869..2907 CDD:238011
Cadherin_C 2952..3088 CDD:279398
DSG4NP_001127925.1 CA 75..155 CDD:214520 29/86 (34%)
Cadherin_repeat 161..265 CDD:206637 34/107 (32%)
Cadherin_repeat 273..379 CDD:206637 28/116 (24%)
Cadherin_repeat 392..492 CDD:206637 32/105 (30%)
Cadherin_C <810..865 CDD:279398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.