DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN and CDH15

DIOPT Version :9

Sequence 1:NP_001027277.1 Gene:CadN / 35070 FlyBaseID:FBgn0015609 Length:3101 Species:Drosophila melanogaster
Sequence 2:NP_004924.1 Gene:CDH15 / 1013 HGNCID:1754 Length:814 Species:Homo sapiens


Alignment Length:1631 Identity:283/1631 - (17%)
Similarity:417/1631 - (25%) Gaps:956/1631 - (58%)


- Green bases have known domain annotations that are detailed below.


  Fly  1515 PPVFERPTYRTQITEEDDRNLPKRVLQVTATDGDKDRPQNIVYFLTGQGIDPDNPANSKFDINRT 1579
            ||:         ...|:.:.||..::|:.:   ||.:..:::|.:.|.|:|.:  ....|.|::.
Human    50 PPI---------SVSENHKRLPYPLVQIKS---DKQQLGSVIYSIQGPGVDEE--PRGVFSIDKF 100

  Fly  1580 TGEIFVLKPLDRDQPNGRPQWRFTVFAQDEGGEGLVGYADVQVNLKDINDNAPIFPQGVYFGNVT 1644
            ||::|:...|||::.:   ::|...||.|.||..|....|:::.:.|.|||.|.|.|..:.|.|.
Human   101 TGKVFLNAMLDREKTD---RFRLRAFALDLGGSTLEDPTDLEIVVVDQNDNRPAFLQEAFTGRVL 162

  Fly  1645 ENGTAGMVVMTMTAVDYDDPNEGSNARLVYSIEKNVIEEETGSP-IFEIEPDTGVIKTAVCCLDR 1708
            |....|..|....|.|.||| |..||.|.:||      .:.||| :|.|:..||.|:|....|||
Human   163 EGAVPGTYVTRAEATDADDP-ETDNAALRFSI------LQQGSPELFSIDELTGEIRTVQVGLDR 220

  Fly  1709 ERTPDY--SIQVVAMDGGGLKGTGTASIRVKDINDMPPQFTKDEWFTE-------VD----ETDG 1760
            |....|  ::||..|.|.||..|.:|.|.:.||||..|:||:||:|.|       ||    |.:.
Human   221 EVVAVYNLTLQVADMSGDGLTATASAIITLDDINDNAPEFTRDEFFMEAIEAVSGVDVGRLEVED 285

  Fly  1761 TALPEMP--ILTVTVHDEDETNKFQYKVIDNSGYGADKFTMVRNNDGTGSLKIVQPLDYEDQLQS 1823
            ..||..|  :...|:.:.|...:|..:            |..:.|:|.  |.||:.||||   ..
Human   286 RDLPGSPNWVARFTILEGDPDGQFTIR------------TDPKTNEGV--LSIVKALDYE---SC 333

  Fly  1824 NGFRFRIQVN------------DKGEDNDNDKYHVAYSWVVVKLRDINDNKPHFERANVEVSVFE 1876
            ..:..::.|.            ::|:           :.|.|.::|.|: .|.|:...:..|:.|
Human   334 EHYELKVSVQNEAPLQAAALRAERGQ-----------AKVRVHVQDTNE-PPVFQENPLRTSLAE 386

  Fly  1877 DTKVGTELEKFKATDPDQGGKSKVSYS----------IDRSSDRQRQFAINQNGSVTIQRSLDRE 1931
            ....||.:..|.|.|||.....::|||          :|.::.|.:...:....|..::....|.
Human   387 GAPPGTLVATFSARDPDTEQLQRLSYSKDYDPEDWLQVDAATGRIQTQHVLSPASPFLKGGWYRA 451

  Fly  1932 VVPRHQVKILAIDDGSPPKTATATLTVIVQDINDNAPKFLKDYRPVLPEHVPPRKVVEILATDDD 1996
            :|       ||.||.|.|:|||.||::.:.::||:||                     :||    
Human   452 IV-------LAQDDASQPRTATGTLSIEILEVNDHAP---------------------VLA---- 484

  Fly  1997 DRSKSNGPPFQFRLDPSADDIIRASFKVEQDQKGANGDGMAVISSLRSFDREQQKEYMIPIVIKD 2061
                   ||                                                        
Human   485 -------PP-------------------------------------------------------- 486

  Fly  2062 HGSPAMTGTSTLTVIIGDVNDNKMQPGSKDIFVYNYQGQSPDTPIGRVYVYDLDDWDLPDKKFYW 2126
                                    .|||                                     
Human   487 ------------------------PPGS------------------------------------- 490

  Fly  2127 EAMEHPRFKLDEDSGMVTMRAGTREGRYHLRFKVYDRKHTQTDIPANVTVTVREIPHEAVVNSGS 2191
                                                               :...||:     |.
Human   491 ---------------------------------------------------LCSEPHQ-----GP 499

  Fly  2192 VRLSGISDEDFIRVWNYRTQSMSRSKMDRFRDKLADLLNTERENVDIFSVQLKRKHPPLTDVRFS 2256
            ..|.|.:|||.                                             ||       
Human   500 GLLLGATDEDL---------------------------------------------PP------- 512

  Fly  2257 AHGSPYYKPVRLNGIVLMHREEIEKDVGINITMVGIDECLYENQMCEGSCTNSLEISP-LPYMVN 2320
             ||:|::                                              .::|| ||.:  
Human   513 -HGAPFH----------------------------------------------FQLSPRLPEL-- 528

  Fly  2321 ANKTALVGVRVDTIADCTCGARNFTKPESCRTTPCHNGGRCVDTRFGPHCSCPVGYTGPRCQQTT 2385
                                                                             
Human   529 ----------------------------------------------------------------- 528

  Fly  2386 RSFRGNGWAWYPPLEMCDESHLSLEFITRKPDGLIIYNGPIVPPERDETLISDFIALELERGYPR 2450
                |..|:    |...:.||..|....:.|:||                               
Human   529 ----GRNWS----LSQVNVSHARLRPRHQVPEGL------------------------------- 554

  Fly  2451 LLIDFGSGTLELRVKTKKTLDDGEWHRIDLFWDTESIRMVVDFCKSAEIAEMEDGTPPEFDDMSC 2515
                                     ||:.|.     :|              :.|.||       
Human   555 -------------------------HRLSLL-----LR--------------DSGQPP------- 568

  Fly  2516 QARGQIPPFNEYLNVNAPLQVGGLYREQFDQSLYFWHYMPTAKGFDGCIRNLVHNSKLYDLAHPG 2580
            |.|.|            ||.|                                            
Human   569 QQREQ------------PLNV-------------------------------------------- 577

  Fly  2581 LSRNSVAGCPQTEEVCAQTETTARCWEHGNCVGSLSEARCHCRPGWTGPACNIPTIPTTFKAQSY 2645
                                |..||.:.|.|:           ||                    
Human   578 --------------------TVCRCGKDGVCL-----------PG-------------------- 591

  Fly  2646 VKYALSFEPDRFSTQVQLRFRTREEYGELFRVSDQHNREYGILEIKDGHLHFRYNLNSLRTEEKD 2710
                                                                             
Human   592 ----------------------------------------------------------------- 591

  Fly  2711 LWLNAIVVNDGQWHVVKVNRYGSAATLELDGGEGRRYNETFEFVGHQWLLVDKQEGVYAGGKAEY 2775
                                   ||.| |.||.|                               
Human   592 -----------------------AAAL-LAGGTG------------------------------- 601

  Fly  2776 TGVRTFEVYADYQKSCLDDIRLEGKHLPLPPAMNGTQWGQATMARNLEKGCPSNKPCSNVICPDP 2840
                                                                             
Human   602 ----------------------------------------------------------------- 601

  Fly  2841 FECVDLWNVYECTCGEGRIMSPDSKGCMDRNECLDMPCMNGATCINLEPRLRYRCICPDGFWGEN 2905
                                                                             
Human   602 ----------------------------------------------------------------- 601

  Fly  2906 CELVQEGQTLKLSMGALAAILVCLLIILILVLVFVV----YNRRREAHIKYPGPDDDVRENIINY 2966
                       ||:|||..:|...|::|:|||:..:    :.:.|...:.: ||.||:|:|::||
Human   602 -----------LSLGALVIVLASALLLLVLVLLVALRARFWKQSRGKGLLH-GPQDDLRDNVLNY 654

  Fly  2967 DDEGGGEDDMTAFDI------TPLQIPIGGPMPPEL---APM-----KMPIMYPVMTLMPGQEPN 3017
            |::||||:|..|:||      |.|.:|:|   ||.|   ||.     :.|.:.|...|      :
Human   655 DEQGGGEEDQDAYDISQLRHPTALSLPLG---PPPLRRDAPQGRLHPQPPRVLPTSPL------D 710

  Fly  3018 VGMFIEEHKKRADGDPNAPPFDDLRNYAYEGGGSTAGSLSSLASGTDDEQQEYDYLGAWGPRFDK 3082
            :..||.:..:.||.||:.||:|....|.|||.||.||:|||:.|...||.|:||||..|||||.:
Human   711 IADFINDGLEAADSDPSVPPYDTALIYDYEGDGSVAGTLSSILSSQGDEDQDYDYLRDWGPRFAR 775

  Fly  3083 LANMYG 3088
            ||:|||
Human   776 LADMYG 781

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadNNP_001027277.1 Cadherin_repeat 178..301 CDD:206637
Cadherin_repeat 337..396 CDD:206637
E_set 449..541 CDD:298831
Cadherin_repeat 549..>625 CDD:206637
Cadherin_repeat 655..752 CDD:206637
Cadherin_repeat 765..853 CDD:206637
Cadherin_repeat 862..964 CDD:206637
Cadherin_repeat 973..1074 CDD:206637
Cadherin_repeat 1083..1166 CDD:206637
Cadherin_repeat <1219..1298 CDD:206637
Cadherin_repeat 1310..1414 CDD:206637
Cadherin_repeat 1423..1514 CDD:206637
Cadherin_repeat 1522..1630 CDD:206637 28/107 (26%)
Cadherin_repeat 1638..1741 CDD:206637 41/105 (39%)
Cadherin_repeat 1762..1861 CDD:206637 22/112 (20%)
Cadherin_repeat 1871..1966 CDD:206637 29/104 (28%)
Cadherin_repeat 1974..2083 CDD:206637 4/108 (4%)
EGF 2350..2380 CDD:278437 0/29 (0%)
LamG 2385..2570 CDD:238058 22/184 (12%)
EGF_2 <2605..2631 CDD:285248 5/25 (20%)
Laminin_G_2 2665..2800 CDD:280389 7/134 (5%)
EGF_CA 2869..2907 CDD:238011 0/37 (0%)
Cadherin_C 2952..3088 CDD:279398 65/149 (44%)
CDH15NP_004924.1 Cadherin_repeat 52..148 CDD:206637 28/112 (25%)
Cadherin_repeat 157..256 CDD:206637 42/105 (40%)
Cadherin_repeat 271..371 CDD:206637 24/127 (19%)
Cadherin_repeat 379..479 CDD:206637 29/106 (27%)
E_set 487..580 CDD:298831 43/517 (8%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 636..663 13/27 (48%)
Cadherin_C 640..781 CDD:279398 65/150 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 676..703 10/29 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5199
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8035
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.