DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15147 and AT4G31360

DIOPT Version :10

Sequence 1:NP_609854.1 Gene:CG15147 / 35069 FlyBaseID:FBgn0032654 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_194864.2 Gene:AT4G31360 / 829263 AraportID:AT4G31360 Length:186 Species:Arabidopsis thaliana


Alignment Length:59 Identity:17/59 - (28%)
Similarity:28/59 - (47%) Gaps:7/59 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DPLQPVLYIDHCRYRQTYRKRALHLHSSLAEALRAIQPRVKLQLRINDKGPPEDGSFEV 66
            ||.:..:.|:||:....::.||:    .:.|||....|.|.:.|   :...|..|.||:
plant    97 DPTRTKIVIEHCKQCNAFKTRAI----QVKEALEGAVPGVTVSL---NPEKPRRGCFEI 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15147NP_609854.1 None
AT4G31360NP_194864.2 Rdx 103..183 CDD:470191 15/53 (28%)

Return to query results.
Submit another query.