DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15147 and CG13186

DIOPT Version :9

Sequence 1:NP_609854.1 Gene:CG15147 / 35069 FlyBaseID:FBgn0032654 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_610725.1 Gene:CG13186 / 36294 FlyBaseID:FBgn0033680 Length:143 Species:Drosophila melanogaster


Alignment Length:127 Identity:29/127 - (22%)
Similarity:50/127 - (39%) Gaps:32/127 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPDKRPLDPLQPV--------------LYIDHCRYRQTYRKRALHLHSSLAEALRAIQPRVKLQL 51
            ||.|:|....:.|              :||:|......::.:|....:...:.:    |..|.||
  Fly     1 MPPKKPAKKKKDVDWSSDEHFSKDRSMIYIEHTYECPIFQTKADECGTFFTQRI----PERKFQL 61

  Fly    52 RINDKG--PPEDGSFEVAIAPQPTDDSTARQSVWTGLRRMPS---------ASKVPHVDDIL 102
            ..|..|  .|.:|:||:..:   .:..|:...:|:||.:.|.         .:.||.|:.||
  Fly    62 VKNRNGRQVPREGAFEIGFS---QNARTSEHLLWSGLEKGPPRRDKFPLDYEALVPDVNRIL 120



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435345
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33638
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.