DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15147 and SELENOH

DIOPT Version :9

Sequence 1:NP_609854.1 Gene:CG15147 / 35069 FlyBaseID:FBgn0032654 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001308264.1 Gene:SELENOH / 280636 HGNCID:18251 Length:122 Species:Homo sapiens


Alignment Length:93 Identity:28/93 - (30%)
Similarity:51/93 - (54%) Gaps:12/93 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QPVLYIDHCRYRQTYRKRALHLHSSLAEALRAIQPRVKLQLRINDKGPPEDGSFEVAIAPQPTDD 75
            :..:.|:||.. :.|.:.|    ::|::|||...|  :|.:::|.. .|..|||||.:. :| |.
Human    33 EATVVIEHCTSURVYGRNA----AALSQALRLEAP--ELPVKVNPT-KPRRGSFEVTLL-RP-DG 88

  Fly    76 STARQSVWTGLRRMPSAS-KVPHVDDIL 102
            |:|  .:|||:::.|... |.|...:::
Human    89 SSA--ELWTGIKKGPPRKLKFPEPQEVV 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15147NP_609854.1 None
SELENOHNP_001308264.1 CXXU_selWTH 36..119 CDD:274013 28/90 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140688
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR33638
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.