DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytalpha and SYT8

DIOPT Version :9

Sequence 1:NP_001188832.1 Gene:Sytalpha / 35068 FlyBaseID:FBgn0261089 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_011518757.1 Gene:SYT8 / 90019 HGNCID:19264 Length:539 Species:Homo sapiens


Alignment Length:415 Identity:114/415 - (27%)
Similarity:176/415 - (42%) Gaps:82/415 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 PAFWVPASVTSTAAIQQQVSNTTEESAPPTSPTGSLKSNTLSYCSTTSVPIARSDKHVVLAMHPS 180
            |..| ||  |.:...||    ..:...||.||:....:      .||::|....|    |.....
Human   136 PGGW-PA--TGSGGRQQ----GRKMGHPPVSPSAPAPA------GTTAIPGLIPD----LVAGTP 183

  Fly   181 RPRVSSMNAKLDHTKIDMTLY---------RSHSQPKTINPVSLNEVRGN--------------- 221
            .||.:.:...|....:.::..         |...:|:....|.|...||.               
Human   184 WPRWALIAGALAAGVLLVSCLLCAACCCCRRHRKKPRDKESVGLGSARGTTTTHLVQPDVDGLES 248

  Fly   222 ----------LHVSLGYDPVGGLLNVRLLEAQNLQPRQFSGTADPYAKVRLLPDKKNFWQTRIHK 276
                      |.:||.:|.....:.|.|.:|.:|:|   .||.||||:|.:.....:..:|::|:
Human   249 SPGDAQQWGCLQLSLEFDFGSQEIRVGLRQAADLRP---GGTVDPYARVSVSTQAGHRHETKVHR 310

  Fly   277 RTLNPVFDEQFVFEVTAGVIDKRTVEILLYDFDAYSRHVCIGGSKLHLANLDLSEQLKLWTPLSS 341
            .||.|||||...|.:....:...|:::.|::|..:|.|..:|..:|.|..:||...|:.|..|..
Human   311 GTLCPVFDETCCFHIPQAELPGATLQVQLFNFKRFSGHEPLGELRLPLGTVDLQHVLEHWYLLGP 375

  Fly   342 ASAQDMKVDLGDIMVSLAYLPSAERLMVVLIKARNLRIVDDARNSSDPYVKVTLLGPGGKKIKKR 406
            .:|...: .:|::..||.|:||:.||.||:::||.||     ...::|||||.|: ...:|.|||
Human   376 PAATQPE-QVGELCFSLRYVPSSGRLTVVVLEARGLR-----PGLAEPYVKVQLM-LNQRKWKKR 433

  Fly   407 KTGVQRGTLNPVYNEALAFDVAKETLKNCVLEFTVVHDGLLGSSEILGRTLIGNSPEVRTEEKIF 471
            ||..::||..|.:|||..|.|....::|..|...|....|...:|.:|:..:|            
Human   434 KTATKKGTAAPYFNEAFTFLVPFSQVQNVDLVLAVWDRSLPLRTEPVGKVHLG------------ 486

  Fly   472 FEEVFRAKNATAQWVPLQEPANNLA 496
                     |.|...|||..|:.||
Human   487 ---------ARASGQPLQHWADMLA 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytalphaNP_001188832.1 C2A_Synaptotagmin-8 218..341 CDD:176033 41/147 (28%)
C2B_Synaptotagmin 352..488 CDD:175975 43/135 (32%)
SYT8XP_011518757.1 C2 257..370 CDD:301316 37/115 (32%)
C2 385..514 CDD:301316 49/145 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.