Sequence 1: | NP_001188832.1 | Gene: | Sytalpha / 35068 | FlyBaseID: | FBgn0261089 | Length: | 504 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021323073.1 | Gene: | pla2g4f.1 / 798864 | ZFINID: | ZDB-GENE-131121-408 | Length: | 866 | Species: | Danio rerio |
Alignment Length: | 336 | Identity: | 67/336 - (19%) |
---|---|---|---|
Similarity: | 106/336 - (31%) | Gaps: | 126/336 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 235 LNVRLLEAQNLQPRQFSGTADPYAKVRLLPDKKNFWQTRIHKRTLNPVFDEQFVFEVTAGVIDKR 299
Fly 300 TVEILLYDFDAYSRHVCIGGSKLHLANLD----------LSEQLK--LW----------TP---- 338
Fly 339 ---------------------------------LSSASAQDMKV----DLGDIMVSLAY------ 360
Fly 361 ---------------------------------------LPSAERLMVVLIKARN---LRIVDDA 383
Fly 384 RNSSDPYVKVTLLGPGGKK---IKKRKTGVQRGTLNPVYNEALAFDVAKETLKNCVLEFTVVHDG 445
Fly 446 LLGSSEILGRT 456 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sytalpha | NP_001188832.1 | C2A_Synaptotagmin-8 | 218..341 | CDD:176033 | 32/164 (20%) |
C2B_Synaptotagmin | 352..488 | CDD:175975 | 33/156 (21%) | ||
pla2g4f.1 | XP_021323073.1 | C2_cPLA2 | 40..159 | CDD:176001 | 29/119 (24%) |
cPLA2_Grp-IVB-IVD-IVE-IVF | 295..835 | CDD:132840 | 22/80 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1028 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |