DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytalpha and Pla2g4f

DIOPT Version :9

Sequence 1:NP_001188832.1 Gene:Sytalpha / 35068 FlyBaseID:FBgn0261089 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_008760344.1 Gene:Pla2g4f / 691907 RGDID:1593370 Length:860 Species:Rattus norvegicus


Alignment Length:253 Identity:59/253 - (23%)
Similarity:99/253 - (39%) Gaps:48/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 YDPVGGLLNVRLLEAQNLQPRQFSGTADPYAKVRLLPDKKNFWQTRIHKRTLNPVFDEQFVFEVT 292
            ||     |.|::|.|:|:|.......||.|.::.|.....:..|||......:|.::|.|.:.:.
  Rat    44 YD-----LQVKVLRARNIQHTDKLSKADCYVQLWLPTASFSPTQTRTVVNCSDPEWNETFHYRIH 103

  Fly   293 AGVIDKRTVEILLYDFDAYSRHVCIGGSKLHLANLDLSEQLKLWTPLSSASAQ------DMKVDL 351
            :.|  |..:|:.|||.|.      :...|:.....||| .|:|..|.:....|      |.|...
  Rat   104 SAV--KNVLELALYDKDV------LDSDKIFSVLFDLS-TLQLGQPYTKTFTQKQPGLTDPKELQ 159

  Fly   352 GDIMVSLAYLPSAERLM-VVLIKARNLRIVDDARNSSDPYV------KVTLLGPGG----KKIKK 405
            .:..:..:.:|:.|.:. .||:....|||...........:      ::.|..||.    :.:..
  Rat   160 VEFTLEKSQMPACEVITNGVLVAHPCLRIQGTVTGDKTASLGEFGSREIQLAVPGAYEKPQSVPL 224

  Fly   406 RKTGVQRGT-------LNPVYNEALAFDVAKETLKNCVLEFTVVHDGLLGSSEILGRT 456
            :.|.|:.|.       :|||.:..|...:.::.|        |.|.|  .|.|:..:|
  Rat   225 QPTTVEPGLPATFIFHMNPVLSPRLNIALQEKLL--------VSHSG--PSDELESQT 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytalphaNP_001188832.1 C2A_Synaptotagmin-8 218..341 CDD:176033 32/112 (29%)
C2B_Synaptotagmin 352..488 CDD:175975 24/123 (20%)
Pla2g4fXP_008760344.1 C2_cPLA2 46..166 CDD:176001 33/128 (26%)
Patatin_and_cPLA2 307..854 CDD:299702
PLAc 313..802 CDD:214474
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.