DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytalpha and Pla2g4d

DIOPT Version :9

Sequence 1:NP_001188832.1 Gene:Sytalpha / 35068 FlyBaseID:FBgn0261089 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_001080051.2 Gene:Pla2g4d / 691905 RGDID:1593372 Length:825 Species:Rattus norvegicus


Alignment Length:100 Identity:31/100 - (31%)
Similarity:53/100 - (53%) Gaps:9/100 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 LNVRLLEAQNLQPRQFSGTADPYAKVRLLPDKKNFWQTRIHKRTLNPVFDEQFVFEVTAGVIDKR 299
            |.|::|||::|........||||..:||.......::|:....:.|||::|.|.|.:.:.|  |.
  Rat    33 LTVKILEARSLPRADLLSKADPYVTLRLPTASGRKFKTQTVTNSSNPVWNETFSFLIQSQV--KN 95

  Fly   300 TVEILLYDFDAYSR-HVCIGGSKLHLANLDLSEQL 333
            .:|:.:||.|..:: .:|.   |:   :.|:||.|
  Rat    96 ILELTVYDEDLITKDDICF---KI---SYDISEIL 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytalphaNP_001188832.1 C2A_Synaptotagmin-8 218..341 CDD:176033 30/99 (30%)
C2B_Synaptotagmin 352..488 CDD:175975
Pla2g4dXP_001080051.2 C2_cPLA2 32..151 CDD:176001 30/99 (30%)
PLAc 267..758 CDD:214474
Patatin_and_cPLA2 278..814 CDD:299702
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.