DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytalpha and pla2g4f.2

DIOPT Version :9

Sequence 1:NP_001188832.1 Gene:Sytalpha / 35068 FlyBaseID:FBgn0261089 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_021323223.1 Gene:pla2g4f.2 / 565386 ZFINID:ZDB-GENE-131127-625 Length:833 Species:Danio rerio


Alignment Length:326 Identity:62/326 - (19%)
Similarity:114/326 - (34%) Gaps:73/326 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 LLNVRLLEAQNLQPRQFSGT----------ADPYAKVRLLPDKKNFWQTRIHKRTLNPVFDEQFV 288
            :|.:.|:...||......||          .|.|..::|........:|:..|.:..|.::|.|.
Zfish    25 MLKIELMPYWNLSVTVLRGTFCQSYDVLSKNDCYVTLKLPTASACCHRTKTVKNSNEPKWNETFH 89

  Fly   289 FEVTAGVIDKRTVEILLYDFDAYSRHVCIGGSKLHLANL------------DLSEQLKLWTPLSS 341
            |.|.:|:  |..:|..::|.|..::...:......::||            |...:..||.....
Zfish    90 FRVHSGI--KNILEFHMFDADKLTKDDHLSTILFDISNLTPGQKQTKCFMSDDERKGALWVEFEM 152

  Fly   342 ASAQDMKVDLG-------------DIMVSLAYLPSAERLMVVLIKA---RNLRIVDDARNSS--- 387
            ..:.:..:...             |:.:......:||..|::.::.   .:..|:....||:   
Zfish   153 TVSSEKPIPYFSNGVLMAGPFCALDVKLQKHLKTNAENKMMLRLRGAYKEDCMILSSDENSNCLQ 217

  Fly   388 --------DPYVKVTLLGPGGKKIKKRKTGVQRGTLNPVYNEALAFDVAKETLKNCVLEFTV--- 441
                    |...:.:||.|........|.......|:.|..:.|:   ||:.:|   |...:   
Zfish   218 NTCFYINRDLETEFSLLPPKAGAEMDEKYANTADILSSVPMKPLS---AKQQMK---LSMPIAQG 276

  Fly   442 -VHDGLLGSSEILGRTLIGNSPEVRTEEKIFFEE---VFRAKNATAQWVPLQEPANNLATSAKSS 502
             ||      .|:.....:....:||.|..|..||   :.:.:...:|  .||: |.||.::...|
Zfish   277 EVH------LELNTEDCLDEEMDVRLEFDIPVEEKNFLLKRRKVVSQ--ALQK-ALNLGSAPDPS 332

  Fly   503 K 503
            |
Zfish   333 K 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytalphaNP_001188832.1 C2A_Synaptotagmin-8 218..341 CDD:176033 26/128 (20%)
C2B_Synaptotagmin 352..488 CDD:175975 29/169 (17%)
pla2g4f.2XP_021323223.1 C2_cPLA2 35..154 CDD:176001 24/120 (20%)
Patatin_and_cPLA2 282..824 CDD:325016 14/55 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.