DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytalpha and SYT10

DIOPT Version :9

Sequence 1:NP_001188832.1 Gene:Sytalpha / 35068 FlyBaseID:FBgn0261089 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_945343.1 Gene:SYT10 / 341359 HGNCID:19266 Length:523 Species:Homo sapiens


Alignment Length:523 Identity:155/523 - (29%)
Similarity:248/523 - (47%) Gaps:103/523 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DISLAQIGVYASVSFLVVSAVGAALYTTCSKRYRLNW--------------FEQNLLESANEKDE 69
            |||::.:.|..|...|.:..|...::      ::|.|              ..|::..:..|..|
Human    51 DISVSLLAVVVSFCGLALLVVSLFVF------WKLCWPCWKSKPVTSNITTLPQSISSAPTEVFE 109

  Fly    70 DQQREALVAGAVGYNVDNVNEVPRGKYSSGNAGNLSPTSLKSEDNDPAFWVPASVTST------- 127
            .::::.:          ..||.|..|       .:.| ::|.....|.  :||.|.:.       
Human   110 TEEKKEI----------KENEKPAVK-------AIEP-AIKISHTSPD--IPAEVQTALKEHLIK 154

  Fly   128 -AAIQQQVSNTTEESAPPTSPTGSLKSNTLSYCSTTSVPIARSDKHVVLAMHPSRPRVSSMNAKL 191
             |.:|:|:          |.||.|.:.::..             :|:     |.:.:|||::..:
Human   155 HARVQRQI----------TEPTSSTRHSSFR-------------RHL-----PRQMQVSSVDFSM 191

  Fly   192 DHT-------------KIDMTLYRSHSQPKTINPVSLNEVRGNLHVSLGYDPVGGLLNVRLLEAQ 243
            ...             :|...||:..|.....|.....::.|.|:.:|.||....||.|::::|.
Human   192 GTEPVLQRGETTTSIGRIKPELYKQKSVDSEGNQNEDVKICGKLNFTLQYDYENELLVVKIIKAL 256

  Fly   244 NLQPRQFSGTADPYAKVRLLPDKKNFWQTRIHKRTLNPVFDEQFVFEVTAGVIDKRTVEILLYDF 308
            :|..:.|:||:|||.|:.||||:|..:|||:|::||||:|||.|.|.|....:..|.:...:|||
Human   257 DLPAKDFTGTSDPYVKMYLLPDRKKKFQTRVHRKTLNPLFDETFQFPVAYDQLSNRKLHFSVYDF 321

  Fly   309 DAYSRHVCIGGSKLHLANL----DLSEQLKLWTPLSSASAQDMKVDLGDIMVSLAYLPSAERLMV 369
            |.:|||..||  ::.|.||    |||.:..:|..:..|:.:  .:|||:||.||.|||:|.|:.:
Human   322 DRFSRHDMIG--EVILDNLFEVSDLSREATVWKDIHCATTE--SIDLGEIMFSLCYLPTAGRMTL 382

  Fly   370 VLIKARNLRIVDDARNSSDPYVKVTLLGPGGKKIKKRKTGVQRGTLNPVYNEALAFDVAKETLKN 434
            .:||.|||:.: |...||||||||:|:.. |:::|||||..::.|||||||||:.||:..|.:..
Human   383 TVIKCRNLKAM-DITGSSDPYVKVSLMCE-GRRLKKRKTTTKKNTLNPVYNEAIIFDIPPENVDQ 445

  Fly   435 CVLEFTVVHDGLLGSSEILGRTLIGNSPEVRTEEKIFFEEVFRAKNATAQWVPLQE-PANNLATS 498
            ..|...|:....:|.:|::|....|...|....:. :.|.:...:.....|.||.| |..  |||
Human   446 VSLSIAVMDYDRVGHNEVIGVCRTGLDAEGLGRDH-WNEMLAYHRKPITHWHPLLELPGR--ATS 507

  Fly   499 AKS 501
            ..|
Human   508 FDS 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytalphaNP_001188832.1 C2A_Synaptotagmin-8 218..341 CDD:176033 53/126 (42%)
C2B_Synaptotagmin 352..488 CDD:175975 52/135 (39%)
SYT10NP_945343.1 Cysteine motif. /evidence=ECO:0000250|UniProtKB:O35681 13..35
C2A_Synaptotagmin-1-5-6-9-10 232..356 CDD:176031 53/125 (42%)
C2B_Synaptotagmin-3-5-6-9-10 365..498 CDD:176048 52/135 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.