DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytalpha and Pla2g4e

DIOPT Version :9

Sequence 1:NP_001188832.1 Gene:Sytalpha / 35068 FlyBaseID:FBgn0261089 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_017447688.1 Gene:Pla2g4e / 296091 RGDID:1310595 Length:900 Species:Rattus norvegicus


Alignment Length:177 Identity:39/177 - (22%)
Similarity:76/177 - (42%) Gaps:22/177 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 LLNVRLLEAQNLQPRQFSGTADPYAKVRLLPDKKNFWQTRIHKRTLNPVFDEQFVFEVTAGVIDK 298
            ||.||::..:|::........|.:..:.|....:...:||......:|.::|.|.|::...|  |
  Rat   107 LLTVRIISMKNVRQADILSQTDCFVTLWLPTASQKKLRTRTISNCPHPEWNESFTFQIQTRV--K 169

  Fly   299 RTVEILLYDFDAYSRHVCIGGSKLHLANLDLSEQLKLWTPLSSASAQDMKVD-LGDIMVSLAYLP 362
            ..:|..:.|.|..::...:......|:.|.|..:..:..||:....::::|: |.:..||     
  Rat   170 NVLEFSICDEDTLTQSDHLLTVLYDLSKLCLRNKTHVKFPLNPEGMEELEVEFLLEENVS----- 229

  Fly   363 SAERLMV--VLIKARNLRIVDDARNSSDPYVKVTLLGPGGKKIKKRK 407
            |:|.|:.  ||: :|.:..::....|..|           :|.||.|
  Rat   230 SSETLITNGVLV-SRQVSCLEVHAESRRP-----------RKRKKNK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytalphaNP_001188832.1 C2A_Synaptotagmin-8 218..341 CDD:176033 23/106 (22%)
C2B_Synaptotagmin 352..488 CDD:175975 14/58 (24%)
Pla2g4eXP_017447688.1 C2_cPLA2 107..215 CDD:176001 23/109 (21%)
cPLA2_C2 247..354 CDD:408472 6/29 (21%)
Patatin_and_cPLA2 353..895 CDD:416256
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.