DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytalpha and Doc2g

DIOPT Version :9

Sequence 1:NP_001188832.1 Gene:Sytalpha / 35068 FlyBaseID:FBgn0261089 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_006230797.1 Gene:Doc2g / 293654 RGDID:1307473 Length:389 Species:Rattus norvegicus


Alignment Length:299 Identity:75/299 - (25%)
Similarity:129/299 - (43%) Gaps:52/299 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 HSQPK-TINPVSLNE-----VRGNLHVSLGYDPVGGLLNVRLLEAQNLQPRQFSGTADPYAKVRL 262
            ||.|: ..||.:..:     ..|.|..:|.:|.....|:.....|:.|:| ..:|:.|.|.|..|
  Rat    63 HSAPQLQPNPEAEGDSDDSTALGTLEFTLLFDVDNSTLHCTAHRAKGLKP-PATGSVDTYVKANL 126

  Fly   263 LPDKKNFWQTRIHKRTL----NPVFDEQFVFE-VTAGVIDKRTVEILLYDFD------------- 309
            ||.......:::..||:    .||::|...:. .|.....::|:.:.:.:..             
  Rat   127 LPGASKVRASQLRTRTVRGTREPVWEETLTYHGFTCQDAGRKTLRLCVCEDSRLRRRRRAPPLGE 191

  Fly   310 ------------AYSRHVCIGGSKL--HLANLDLSEQLKLWTPLSSASAQDMKVDLGDIMVSLAY 360
                        |.|..:|:...:|  ...:||.:..:.|:.. ....|:..:.:.|.|::||.|
  Rat   192 LRVPLRKLVPNRARSFDICLEKRRLTKRPKSLDTARGMSLYEE-EEVEAEVFREERGRILLSLCY 255

  Fly   361 LPSAER--LMVVLIKARNLRIVDDARNSSDPYVKVTLLGPGGKKIKKRKTGVQRGTLNPVYNEAL 423
              |:||  |:|.:::..:|..: ||...|||:|::.|....||| .|.||.|:|.||||.:||..
  Rat   256 --SSERGGLLVGVLRCAHLAPM-DANGYSDPFVRLFLHPSSGKK-SKYKTSVRRKTLNPEFNEEF 316

  Fly   424 AFDVAKETLKNCVLEFTV------VHDGLLGSSEILGRT 456
            .:...:|.|....|..:|      ..|..:|..::.||:
  Rat   317 FYAGLREELAQKALLVSVWDYDLGTADDFIGGVQLSGRS 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytalphaNP_001188832.1 C2A_Synaptotagmin-8 218..341 CDD:176033 29/154 (19%)
C2B_Synaptotagmin 352..488 CDD:175975 40/113 (35%)
Doc2gXP_006230797.1 C2A_Rabphilin_Doc2 84..211 CDD:176000 24/127 (19%)
C2 248..380 CDD:301316 39/112 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.