DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytalpha and PLA2G4D

DIOPT Version :9

Sequence 1:NP_001188832.1 Gene:Sytalpha / 35068 FlyBaseID:FBgn0261089 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_828848.3 Gene:PLA2G4D / 283748 HGNCID:30038 Length:818 Species:Homo sapiens


Alignment Length:154 Identity:49/154 - (31%)
Similarity:79/154 - (51%) Gaps:19/154 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 LNVRLLEAQNLQPRQFSGTADPYAKVRL--LPDKKNFWQTRIHKRTLNPVFDEQFVFEVTAGVID 297
            |.||:|||:||:.......||||..::|  .|..|  ::|:....|.:||::|.|.|.:.:.|  
Human    24 LTVRVLEARNLRWADLLSEADPYVILQLSTAPGMK--FKTKTLTDTSHPVWNEAFRFLIQSQV-- 84

  Fly   298 KRTVEILLYDFDAYSR-HVCIGGSKLHLANLDLSEQL--KLWTPLSSASAQ-DMKVDLGDIMVSL 358
            |..:|:.:||.|:.:. .:|.  ..|:    |:||.|  ||.....|.|.| :.::|:..:|...
Human    85 KNVLELSIYDEDSVTEDDICF--KVLY----DISEVLPGKLLRKTFSQSPQGEEELDVEFLME
ET 143

  Fly   359 AYLPSAERLMV-VLIKARNLRIVD 381
            :..|  |.|:. .:|.||.|..:|
Human   144 SDRP--ENLITNKVIVARELSCLD 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytalphaNP_001188832.1 C2A_Synaptotagmin-8 218..341 CDD:176033 36/110 (33%)
C2B_Synaptotagmin 352..488 CDD:175975 9/31 (29%)
PLA2G4DNP_828848.3 C2_cPLA2 23..141 CDD:176001 40/126 (32%)
cPLA2_Grp-IVB-IVD-IVE-IVF 269..811 CDD:132840
Substrate binding. /evidence=ECO:0000269|PubMed:27220631, ECO:0007744|PDB:5IXC, ECO:0007744|PDB:5IZR 330..331
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.