DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytalpha and Sytl1

DIOPT Version :9

Sequence 1:NP_001188832.1 Gene:Sytalpha / 35068 FlyBaseID:FBgn0261089 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_113570.2 Gene:Sytl1 / 269589 MGIID:1933365 Length:568 Species:Mus musculus


Alignment Length:465 Identity:106/465 - (22%)
Similarity:192/465 - (41%) Gaps:92/465 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ESANEKDEDQQREALVAGAVGYNVDNVNEVPRGKYSSGNAGNLSPTSLKSEDNDPAFWVPASVTS 126
            |...|:.:||:.|....|..|..|...:.            .|.|.....:::.|   .||...:
Mouse   169 EGQEEEPQDQECELEAPGEGGVQVAEADP------------ELDPEQKAEQESQP---TPAQSKA 218

  Fly   127 TAAIQQQVSNTTEESAPPTSPTGSLKSNTLSYCSTTSVPIARSDKHVVLAMHPSRPRVSSMNAK- 190
            |:.|.:     ..|.||...|:                    .|:     |..|...|||:|:. 
Mouse   219 TSKILE-----NGEEAPGLGPS--------------------LDR-----MLSSSSSVSSLNSST 253

  Fly   191 LDHTKIDMTLYRSHSQPKTINPVSLNEVRGNLHVSLGYDPVGGLLNVRLLEAQNLQPRQFSGTAD 255
            |..:.:.::   ..::..|:      :|||::..||.|:|....|.|::::.|.|...: ...:|
Mouse   254 LSGSLMSLS---GEAEAGTV------QVRGSVLFSLRYEPGTSELRVQVIQCQGLAAAR-RRRSD 308

  Fly   256 PYAKVRLLPDKKNFWQTRIHKRTLNPVFDEQFVFEVTAGVIDKRTVEILLYDFDAYSRHVCIGGS 320
            ||.|..|||||::..:|.:.||.|||:|:|.....|....:..|.:.:.::..::..|::.:|..
Mouse   309 PYVKSYLLPDKQSKRKTSVKKRNLNPIFNETLRHSVQQADLPGRVLSLSVWHRESLGRNIFLGEV 373

  Fly   321 KLHLANLDLSEQLKLWTPLSS--ASAQDMKVDLGDIMVSLAYLPSAE---------RLMVVLIKA 374
            ::.|...:...: ..|.||..  ..:.|.....|.:.:||.|:|:..         .|...:.:|
Mouse   374 EVPLDTWNWDSE-ATWLPLQPRVPPSPDELPSRGLLSLSLKYVPAGSEGGGQPQSGELHFWVKEA 437

  Fly   375 RNLRIVDDARNSSDPYVKVTLLGPGGKKIKKRKTGVQRGTLNPVYNEALAFD-VAKETLKNCVLE 438
            ::|  |.....|.|.|::.::| |...:..:::|.|.|.:|:||:|..:.:| .....|:....|
Mouse   438 QSL--VPLRPGSLDTYIQCSVL-PDDSRASRQRTRVVRRSLSPVFNHTMVYDGFGPADLRQACAE 499

  Fly   439 FTVVHDGLLGSSEILGRTL---IGNSPEVRT-------EEKIFFEEVFRAKNATAQWV----PLQ 489
            .::...|.|.|.::.|..|   .|:|..::.       |||..::.:.   ....:||    ||:
Mouse   500 LSLWDHGALASRQLGGTRLSLGTGSSYGLQVPWMDSTPEEKQLWQTLL---ERPCEWVDGLLPLR 561

  Fly   490 EPANNLATSA 499
               .||...|
Mouse   562 ---TNLVPRA 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytalphaNP_001188832.1 C2A_Synaptotagmin-8 218..341 CDD:176033 36/122 (30%)
C2B_Synaptotagmin 352..488 CDD:175975 36/159 (23%)
Sytl1NP_113570.2 PHD_SF 35..>99 CDD:389947
NESP55 <92..230 CDD:115071 16/80 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..255 26/130 (20%)
C2 273..392 CDD:387358 34/120 (28%)
C2B_SLP_1-2-3-4 405..561 CDD:175987 37/161 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.