DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytalpha and PLA2G4F

DIOPT Version :9

Sequence 1:NP_001188832.1 Gene:Sytalpha / 35068 FlyBaseID:FBgn0261089 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_998765.3 Gene:PLA2G4F / 255189 HGNCID:27396 Length:849 Species:Homo sapiens


Alignment Length:279 Identity:67/279 - (24%)
Similarity:117/279 - (41%) Gaps:53/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 YDPVGGLLNVRLLEAQNLQPRQFSGTADPYAKVRLLPDKKNFWQTRIHKRTLNPVFDEQFVFEVT 292
            ||     |.|::|.|.|::.......||.|.::.|.....:..||||.....:|.::|.|.:::.
Human    44 YD-----LQVKVLRATNIRGTDLLSKADCYVQLWLPTASPSPAQTRIVANCSDPEWNETFHYQIH 103

  Fly   293 AGVIDKRTVEILLYDFDAYSRHVCIGGSKLHLANLDL-----SEQLKLWTPLSSASAQDMKVDLG 352
            ..|  |..:|:.|||.|      .:|..:|.|...||     .:..|...||:...:|:::|   
Human   104 GAV--KNVLELTLYDKD------ILGSDQLSLLLFDLRSLKCGQPHKHTFPLNHQDSQELQV--- 157

  Fly   353 DIMVSLAYLPSAERLM-VVLIKARNLRIVDDARNSS----DPY--VKVTLLGPGGKKIKKRKTGV 410
            :.::..:.:|::|.:. .||:....|||....|...    :.|  .::.|..||..: |.:...:
Human   158 EFVLEKSQVPASEVITNGVLVAHPCLRIQGTLRGDGTAPREEYGSRQLQLAVPGAYE-KPQLLPL 221

  Fly   411 QRGT-----------LNPVYNEALAFDV-----AKETLKNCVLE---FTVVHDGLLGSSEILGR- 455
            |..|           :|||.:..|..::     |.::..:..||   ..:...|:|.||..||: 
Human   222 QPPTEPGLPPTFTFHVNPVLSSRLHVELMELLAAVQSGPSAELEAQTSKLGEGGILLSSLPLGQE 286

  Fly   456 ----TLIGNSPEVRTEEKI 470
                ..:|...||....|:
Human   287 EQCSVALGEGQEVALSMKV 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytalphaNP_001188832.1 C2A_Synaptotagmin-8 218..341 CDD:176033 33/117 (28%)
C2B_Synaptotagmin 352..488 CDD:175975 32/150 (21%)
PLA2G4FNP_998765.3 C2_cPLA2 46..163 CDD:176001 33/127 (26%)
PLAc 295..791 CDD:214474 3/11 (27%)
cPLA2_Grp-IVB-IVD-IVE-IVF 303..845 CDD:132840 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.