DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytalpha and Syt2

DIOPT Version :9

Sequence 1:NP_001188832.1 Gene:Sytalpha / 35068 FlyBaseID:FBgn0261089 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_038946276.1 Gene:Syt2 / 24805 RGDID:3804 Length:499 Species:Rattus norvegicus


Alignment Length:270 Identity:100/270 - (37%)
Similarity:162/270 - (60%) Gaps:4/270 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 GNLHVSLGYDPVGGLLNVRLLEAQNLQPRQFSGTADPYAKVRLLPDKKNFWQTRIHKRTLNPVFD 284
            |.|..||.||.....|.|.:|:|..|......||:|||.||.||||||..::|::|::||||.|:
  Rat   221 GKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFN 285

  Fly   285 EQFVFEVTAGVIDKRTVEILLYDFDAYSRHVCIGGSKLHLANLDLSEQLKLWTPLSSASAQDMKV 349
            |.|.|:|....:..:|:.:.:||||.:|:|..||..|:.:..:||.:.::.|..|.....::.: 
  Rat   286 ETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPE- 349

  Fly   350 DLGDIMVSLAYLPSAERLMVVLIKARNLRIVDDARNSSDPYVKVTLLGPGGKKIKKRKTGVQRGT 414
            .||||..||.|:|:|.:|.|.:::|:||:.: |....||||||:.|: ..||::||:||.|::.|
  Rat   350 KLGDICTSLRYVPTAGKLTVCILEAKNLKKM-DVGGLSDPYVKIHLM-QNGKRLKKKKTTVKKKT 412

  Fly   415 LNPVYNEALAFDVAKETLKNCVLEFTVVHDGLLGSSEILGRTLIGNSPEVRTEEKIFFEEVFRAK 479
            |||.:||:.:|::..|.::...:..||:....||.:|.:|:..:| |....||.:.:.:.:...:
  Rat   413 LNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVG-SNATGTELRHWSDMLANPR 476

  Fly   480 NATAQWVPLQ 489
            ...|||..|:
  Rat   477 RPIAQWHSLK 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytalphaNP_001188832.1 C2A_Synaptotagmin-8 218..341 CDD:176033 49/120 (41%)
C2B_Synaptotagmin 352..488 CDD:175975 49/135 (36%)
Syt2XP_038946276.1 Syt2_N 81..193 CDD:409249
C2A_Synaptotagmin-1-5-6-9-10 219..341 CDD:176031 48/119 (40%)
C2B_Synaptotagmin-1 351..486 CDD:176047 50/137 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.