DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytalpha and snt-3

DIOPT Version :9

Sequence 1:NP_001188832.1 Gene:Sytalpha / 35068 FlyBaseID:FBgn0261089 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001379881.1 Gene:snt-3 / 190698 WormBaseID:WBGene00004923 Length:284 Species:Caenorhabditis elegans


Alignment Length:274 Identity:94/274 - (34%)
Similarity:158/274 - (57%) Gaps:10/274 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 GNLHVSLGYDPVGGLLNVRLLEAQNLQPRQFSGTADPYAKVRLLPDKKNFWQTRIHKRTLNPVFD 284
            |.|...|.||.....|.|.:::|:.|......||:|||.|:.||||||...||::.:::|||||:
 Worm    17 GRLQYKLDYDFDKNSLTVVIIQAEELPAMDLGGTSDPYVKLFLLPDKKKKLQTKVQRKSLNPVFN 81

  Fly   285 EQFVFEVTAGVIDKRTVEILLYDFDAYSRHVCIGGSKLHLANLDLSEQLKLWTPLSSASAQDMKV 349
            |.|.|::....|..:|:.:.::|||.:.:|..||...:.|..:||:..|:. |.|..:..::.  
 Worm    82 ESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQIGQISIPLGKVDLAATLER-TDLIESPPENR-- 143

  Fly   350 DLGDIMVSLAYLPSAERLMVVLIKARNLRIVDDARNSSDPYVKVTLLGPGGKKIKKRKTGVQRGT 414
             ||::.::|.|:|:..:|.||:::.:||:.: |....||||||:.|: .|.|:::|:||.::..|
 Worm   144 -LGEVCLALRYVPNKNKLSVVVMECKNLKKM-DVLGLSDPYVKIYLM-MGTKRLEKKKTTIKMKT 205

  Fly   415 LNPVYNEALAFDVAKETLKNCVLEFTVVHDGLLGSSEILGRTLIGNSPEVRTEEKIFFEEVFRAK 479
            |||.|||:.:|||..|.::...|..||.....:||:|.:|:.:||.. ......|.:.:.:...:
 Worm   206 LNPYYNESFSFDVTSEKMQRVHLHVTVSDYDRVGSNERIGQVIIGTC-ATGVALKQWNDMLATPR 269

  Fly   480 NATAQW---VPLQE 490
            .:.|||   ||..:
 Worm   270 RSVAQWHTLVPFND 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytalphaNP_001188832.1 C2A_Synaptotagmin-8 218..341 CDD:176033 45/120 (38%)
C2B_Synaptotagmin 352..488 CDD:175975 47/138 (34%)
snt-3NP_001379881.1 C2 16..131 CDD:417471 42/113 (37%)
C2B_Synaptotagmin-1 144..278 CDD:176047 47/136 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.