DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytalpha and SYT6

DIOPT Version :9

Sequence 1:NP_001188832.1 Gene:Sytalpha / 35068 FlyBaseID:FBgn0261089 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001353153.1 Gene:SYT6 / 148281 HGNCID:18638 Length:528 Species:Homo sapiens


Alignment Length:478 Identity:149/478 - (31%)
Similarity:232/478 - (48%) Gaps:82/478 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EEDISLAQIGVYASVSFLVVSAVGAALYTT-CSKRYRLNWFEQNLLESANEKDEDQQREALVAGA 80
            |...|.|..|...|:..:||...|.||... ....::|.|......|:::....:...|||    
Human    46 ERSPSAAGAGTSVSLLAVVVIVCGVALVAVFLFLFWKLCWMPWRNKEASSPSSANPPLEAL---- 106

  Fly    81 VGYNVDNVNEVPRGKYSSGNAGNLSPTSLKSEDNDPAFWVPASVTSTAAIQQQVSNTTEESAPPT 145
                           .|....||::.   |.:|.....::.|:|        ::|:|:.:.  |.
Human   107 ---------------QSPSFRGNMAD---KLKDPSTLGFLEAAV--------KISHTSPDI--PA 143

  Fly   146 SPTGSLKSNTLSYC---STTSVPIARSDKHVVLAMH-PSRPRVSSMNAKLDHTKIDMTLYRSHSQ 206
            ....|:|.:.:.:.   ..|:.| |.|.:|.....| |.:..|||::            |.:...
Human   144 EVQMSVKEHIMRHTRLQRQTTEP-ASSTRHTSFKRHLPRQMHVSSVD------------YGNELP 195

  Fly   207 PKTINPVSLNEVR----------------------GNLHVSLGYDPVGGLLNVRLLEAQNLQPRQ 249
            |....|.|:..::                      |.::.||.||.....|.||:|:|.:|..:.
Human   196 PAAEQPTSIGRIKPELYKQKSVDGEDAKSEATKSCGKINFSLRYDYETETLIVRILKAFDLPAKD 260

  Fly   250 FSGTADPYAKVRLLPDKKNFWQTRIHKRTLNPVFDEQFVFEVTAGVIDKRTVEILLYDFDAYSRH 314
            |.|::|||.|:.||||:|...|||:|::||||.|||.|.|.|....:..|.:.:.::|||.:|||
Human   261 FCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTFDENFHFPVPYEELADRKLHLSVFDFDRFSRH 325

  Fly   315 VCIGGSKLHLANL----DLSEQLKLWTPLSSASAQDMKVDLGDIMVSLAYLPSAERLMVVLIKAR 375
            ..||  ::.|.||    |||.:..:|..:..|:::  .||||:||.||.|||:|.||.:.:||.|
Human   326 DMIG--EVILDNLFEASDLSRETSIWKDIQYATSE--SVDLGEIMFSLCYLPTAGRLTLTVIKCR 386

  Fly   376 NLRIVDDARNSSDPYVKVTLLGPGGKKIKKRKTGVQRGTLNPVYNEALAFDVAKETLKNCVLEFT 440
            ||:.: |....|||||||:|| ..|:::||:||.:::.|||||||||:.||:..|.:....|..:
Human   387 NLKAM-DITGYSDPYVKVSLL-CDGRRLKKKKTTIKKNTLNPVYNEAIIFDIPPENMDQVSLLIS 449

  Fly   441 VVHDGLLGSSEILGRTLIGNSPE 463
            |:....:|.:||:|...:|.:.|
Human   450 VMDYDRVGHNEIIGVCRVGITAE 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytalphaNP_001188832.1 C2A_Synaptotagmin-8 218..341 CDD:176033 52/148 (35%)
C2B_Synaptotagmin 352..488 CDD:175975 51/112 (46%)
SYT6NP_001353153.1 Cysteine motif. /evidence=ECO:0000250|UniProtKB:O35681 12..38
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..178 5/21 (24%)
C2A_Synaptotagmin-1-5-6-9-10 230..354 CDD:176031 52/125 (42%)
C2B_Synaptotagmin-3-5-6-9-10 363..496 CDD:176048 51/112 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.