DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytalpha and Doc2a

DIOPT Version :9

Sequence 1:NP_001188832.1 Gene:Sytalpha / 35068 FlyBaseID:FBgn0261089 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001355284.1 Gene:Doc2a / 13446 MGIID:109446 Length:405 Species:Mus musculus


Alignment Length:298 Identity:91/298 - (30%)
Similarity:143/298 - (47%) Gaps:37/298 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 GNLHVSLGYDPVGGLLNVRLLEAQNLQPRQFSGTADPYAKVRLLPD--KKNFWQTRIHKRTLNPV 282
            |.|...|.||....:|:.|:|.|:.|:|..|:|.||||.|:.|||.  |.|..:|:..:.|||||
Mouse    96 GTLEFDLLYDQASCMLHCRILRAKGLKPMDFNGLADPYVKLHLLPGACKANKLKTKTQRNTLNPV 160

  Fly   283 FDEQFVFE-VTAGVIDKRTVEILLYDFDAYSRHVCIG-----------GSKLHLANLDLSEQLKL 335
            ::|:..:. :|...|..:.:.|.:.|.|..|.:..||           ..|.|. |:.|..|:.|
Mouse   161 WNEELTYSGITDDDITHKVLRISVCDEDKLSHNEFIGEIRVPLRRLKPSQKKHF-NICLERQVPL 224

  Fly   336 WTPLSSASA-----------------QDMKVDLGDIMVSLAYLPSAERLMVVLIKARNLRIVDDA 383
            .:|.|.::|                 ..:..:.|.|::||:|......|:|.:::..:|..: |.
Mouse   225 PSPSSMSAALRGISCYLKELEQAEQGPGLLEERGRILLSLSYSSRRHGLLVGIVRCAHLAAM-DV 288

  Fly   384 RNSSDPYVKVTLLGPGGKKIKKRKTGVQRGTLNPVYNEALAFDVAKETLKNCVLEFTVVHDGLLG 448
            ...|||||| |.|.|...|..|.||.|::.||||.:||...:::...||....||.||....:..
Mouse   289 NGYSDPYVK-TYLRPDVDKKSKHKTCVKKKTLNPEFNEEFFYEIELSTLATKTLEVTVWDYDIGK 352

  Fly   449 SSEILGRTLIGNSPEVRTE-EKIFFEEVFRAKNATAQW 485
            |::.:|...:|  |..|.| :|.:.:.:.:...|..:|
Mouse   353 SNDFIGGVSLG--PGARGEAQKHWNDCLHQPDTALERW 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytalphaNP_001188832.1 C2A_Synaptotagmin-8 218..341 CDD:176033 45/134 (34%)
C2B_Synaptotagmin 352..488 CDD:175975 44/135 (33%)
Doc2aNP_001355284.1 Interaction with UNC13D and DYNLT1. /evidence=ECO:0000250 1..94
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..54
C2A_Rabphilin_Doc2 95..218 CDD:176000 41/122 (34%)
Interaction with UNC13D. /evidence=ECO:0000250 220..405 49/173 (28%)
C2B_Rabphilin_Doc2 259..391 CDD:176030 43/134 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.