DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytalpha and TC2N

DIOPT Version :9

Sequence 1:NP_001188832.1 Gene:Sytalpha / 35068 FlyBaseID:FBgn0261089 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001122067.2 Gene:TC2N / 123036 HGNCID:19859 Length:490 Species:Homo sapiens


Alignment Length:419 Identity:88/419 - (21%)
Similarity:158/419 - (37%) Gaps:105/419 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SEDNDPAFWVPASVTSTAAIQQQVSNTTEESAPPTSPTGSLKSNTLSYCS--TTSVP----IARS 169
            |..:.|::    .|.:...:.|.:|.......||.|....|..   |.|.  |..:|    :::|
Human   117 SSQHGPSY----DVYNPFYMYQHISPDLSRRFPPRSEVKRLYG---SVCDLRTNKLPGSPGLSKS 174

  Fly   170 ------------DKHVVLAMHPSRPRVSSMNAKLDHTKIDMTLYRSHSQPKTINPVSLN-EVR-- 219
                        .:|..|:..||    ||.:.|           .|....::::.::|: :.|  
Human   175 MFDLTNSSQRFIQRHDSLSSVPS----SSSSRK-----------NSQGSNRSLDTITLSGDERDF 224

  Fly   220 GNLHVSLGYDPVGGLLNVRLLEAQNLQ-PRQFSGTADPYAK-VRLLPDKKNFWQTRIHKRTLNPV 282
            |.|:|.|.|:.....:.:.:|:.::|. |..:..|.....| :..||...:|..:.  |...|.:
Human   225 GRLNVKLFYNSSVEQIWITVLQCRDLSWPSSYGDTPTVSIKGILTLPKPVHFKSSA--KEGSNAI 287

  Fly   283 -FDEQFVFEVTAGVIDKRTVEILLYDFDAYSRHVCIGGSKLHLANLDLSE---QLKLWTPLSSAS 343
             |.|.|||.:.  :.:.:||.::........|...||...:.|..|...|   .|.: ||.|..|
Human   288 EFMETFVFAIK--LQNLQTVRLVFKIQTQTPRKKTIGECSMSLRTLSTQEMDYSLDI-TPPSKIS 349

  Fly   344 AQDMKVDLGDIMVSLAYLPSAERLMVVLIKARNLRIVDDARNSSDP-----YVKVTLLGPGGKKI 403
            ....:::||....::     ..|:.:.:::||.|      .:||.|     :|||.:.. .|:.|
Human   350 VCHAELELGTCFQAV-----NSRIQLQILEARYL------PSSSTPLTLSFFVKVGMFS-SGELI 402

  Fly   404 KKRKTGVQRGTLNPV-YNEALAFDVAKETLKNCVLEFTVVHDGLLGSSEILGRTLIGNSPEVRTE 467
            .|:||.:.:.:...| :.|.:.|                              .||.:..|:...
Human   403 YKKKTRLLKASNGRVKWGETMIF------------------------------PLIQSEKEIVFL 437

  Fly   468 EKIFFEEVFRAKNATAQ-WVPLQEPANNL 495
            .|::.....|.|:...| |:  .|.:||:
Human   438 IKLYSRSSVRRKHFVGQIWI--SEDSNNI 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytalphaNP_001188832.1 C2A_Synaptotagmin-8 218..341 CDD:176033 32/130 (25%)
C2B_Synaptotagmin 352..488 CDD:175975 27/142 (19%)
TC2NNP_001122067.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..215 8/40 (20%)
C2A_Tac2-N 240..342 CDD:176066 24/105 (23%)
C2B_Tac2-N 353..487 CDD:176074 31/156 (20%)
Nuclear localization signal. /evidence=ECO:0000255 447..449 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.