DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytalpha and LOC103909492

DIOPT Version :9

Sequence 1:NP_001188832.1 Gene:Sytalpha / 35068 FlyBaseID:FBgn0261089 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_009293982.1 Gene:LOC103909492 / 103909492 -ID:- Length:185 Species:Danio rerio


Alignment Length:158 Identity:52/158 - (32%)
Similarity:82/158 - (51%) Gaps:6/158 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 KLDHTKIDMTLYRSHSQPKTINPVSLNEVRGNLHVSLGYDPVGGLLNVRLLEAQNLQPRQFSGTA 254
            |..|...|.......|:.|....:      |.|..:|.|:.....|.|.::.|:.|.....|||:
Zfish    34 KAVHHTTDSDAKEEDSESKEAQKL------GKLLYTLDYNFTDSTLIVGVIRAEGLAAMDMSGTS 92

  Fly   255 DPYAKVRLLPDKKNFWQTRIHKRTLNPVFDEQFVFEVTAGVIDKRTVEILLYDFDAYSRHVCIGG 319
            |||.||.||||||..::|::|::||.|.|:|.|.|:|....:..:|:.:.:||||.:|:|..||.
Zfish    93 DPYVKVYLLPDKKKKFETKVHRKTLEPTFNEHFTFKVPYAELGGKTLVMTVYDFDRFSKHDAIGD 157

  Fly   320 SKLHLANLDLSEQLKLWTPLSSASAQDM 347
            .:|.:..:|.|...:.|..|..|..:::
Zfish   158 VRLQMNKVDFSHLTEEWRDLQKAEKEEV 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytalphaNP_001188832.1 C2A_Synaptotagmin-8 218..341 CDD:176033 46/122 (38%)
C2B_Synaptotagmin 352..488 CDD:175975
LOC103909492XP_009293982.1 C2A_Synaptotagmin-1-5-6-9-10 56..179 CDD:176031 46/128 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.