DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and CYB5

DIOPT Version :9

Sequence 1:NP_001286018.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_014288.3 Gene:CYB5 / 855612 SGDID:S000005055 Length:120 Species:Saccharomyces cerevisiae


Alignment Length:113 Identity:39/113 - (34%)
Similarity:68/113 - (60%) Gaps:18/113 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LPEI-ALEEVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTGHSGDA 104
            :|:: :.:|||:|:..::.|::|.|:||||:.|..:|||||::|||..|:|||.:|...|||.:|
Yeast     1 MPKVYSYQEVAEHNGPENFWIIIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIGHSDEA 65

  Fly   105 IEMMKDFLIGQL-PTKQHI----FRTGKNK------------VLSLGI 135
            :.::|...||.: .|.:.:    ..|.:|:            :|.||:
Yeast    66 LRLLKGLYIGDVDKTSERVSVEKVSTSENQSKGSGTLVVILAILMLGV 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_001286018.1 Cyt-b5 46..116 CDD:395121 32/69 (46%)
CYB5NP_014288.3 CYB5 <1..119 CDD:227599 39/113 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100589
Panther 1 1.100 - - O PTHR19359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.