DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and SCS7

DIOPT Version :10

Sequence 1:NP_609852.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_013999.1 Gene:SCS7 / 855315 SGDID:S000004885 Length:384 Species:Saccharomyces cerevisiae


Alignment Length:87 Identity:38/87 - (43%)
Similarity:55/87 - (63%) Gaps:7/87 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VAQHDSFDDCWVVIYDR-VYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTG---HSGDAIEMMK 109
            |.:|::.:||||...:| :||||.||.:|||||:.|:|:||:|.|.....:.   ||..|.|:::
Yeast    17 VQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIMKDSDVHEHSDSAYEILE 81

  Fly   110 D-FLIGQLPTKQHIFR--TGKN 128
            | :|||.|.|.:...|  |.||
Yeast    82 DEYLIGYLATDEEAARLLTNKN 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_609852.1 Cyt-b5 46..116 CDD:459698 32/71 (45%)
SCS7NP_013999.1 Cyt-b5 13..90 CDD:459698 32/72 (44%)
FA_hydroxylase 149..380 CDD:412761
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.