DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and IRC21

DIOPT Version :9

Sequence 1:NP_001286018.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_013789.1 Gene:IRC21 / 855095 SGDID:S000004677 Length:201 Species:Saccharomyces cerevisiae


Alignment Length:81 Identity:25/81 - (30%)
Similarity:42/81 - (51%) Gaps:10/81 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PSK-KERLKLEDLP--------EIALEEVAQH-DSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIM 84
            ||: |.:|.::.:|        .|..:.|.:| ...|:.|.||..:|||::.:|:.||||.|:::
Yeast   102 PSQLKNQLLVQKIPLYKIMPPLRINRKIVKKHCKGEDELWCVINGKVYDISSYLKFHPGGTDILI 166

  Fly    85 DHAGRDATIAFHGTGH 100
            .|...|..|.:....|
Yeast   167 KHRNSDDLITYFNKYH 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_001286018.1 Cyt-b5 46..116 CDD:395121 19/56 (34%)
IRC21NP_013789.1 CYB5 30..>199 CDD:227599 25/81 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13736
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.