DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and CYB2

DIOPT Version :9

Sequence 1:NP_001286018.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_013658.1 Gene:CYB2 / 854950 SGDID:S000004518 Length:591 Species:Saccharomyces cerevisiae


Alignment Length:109 Identity:43/109 - (39%)
Similarity:57/109 - (52%) Gaps:21/109 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EIALEEVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTGHSGDAI-- 105
            :|:..|||:|:..|||||||...|||:|.||.:||||.|||..:||:|.|..|... |:.:.|  
Yeast    90 KISPAEVAKHNKPDDCWVVINGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAIFEPL-HAPNVIDK 153

  Fly   106 ----EMMKDFLIGQLP------------TKQHIFRTGKNKVLSL 133
                |.....|.|.:|            ||:.|.|  |.::.||
Yeast   154 YIAPEKKLGPLQGSMPPELVCPPYAPGETKEDIAR--KEQLKSL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_001286018.1 Cyt-b5 46..116 CDD:395121 34/75 (45%)
CYB2NP_013658.1 CYB5 34..187 CDD:227599 38/97 (39%)
FCB2_FMN 206..555 CDD:239238
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.