DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and CYB2

DIOPT Version :10

Sequence 1:NP_609852.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_013658.1 Gene:CYB2 / 854950 SGDID:S000004518 Length:591 Species:Saccharomyces cerevisiae


Alignment Length:109 Identity:43/109 - (39%)
Similarity:57/109 - (52%) Gaps:21/109 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EIALEEVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTGHSGDAI-- 105
            :|:..|||:|:..|||||||...|||:|.||.:||||.|||..:||:|.|..|... |:.:.|  
Yeast    90 KISPAEVAKHNKPDDCWVVINGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAIFEPL-HAPNVIDK 153

  Fly   106 ----EMMKDFLIGQLP------------TKQHIFRTGKNKVLSL 133
                |.....|.|.:|            ||:.|.|  |.::.||
Yeast   154 YIAPEKKLGPLQGSMPPELVCPPYAPGETKEDIAR--KEQLKSL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_609852.1 Cyt-b5 46..116 CDD:459698 34/75 (45%)
CYB2NP_013658.1 Cyt-b5 92..164 CDD:459698 32/72 (44%)
FCB2_FMN 206..555 CDD:239238
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.