DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and OLE1

DIOPT Version :9

Sequence 1:NP_001286018.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_011460.3 Gene:OLE1 / 852825 SGDID:S000003023 Length:510 Species:Saccharomyces cerevisiae


Alignment Length:116 Identity:31/116 - (26%)
Similarity:52/116 - (44%) Gaps:17/116 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VPSKKERLK----LEDLPEIALEEVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGR 89
            :..||.::.    |.|||....:........:...|:|...|:||:.::.:||||:.:|....|:
Yeast   393 INKKKAKINWGPVLTDLPMWDKQTFLAKSKENKGLVIISGIVHDVSGYISEHPGGETLIKTALGK 457

  Fly    90 DATIAFHG--TGHSGDAIEMMKDFLIGQLPTKQH-----------IFRTGK 127
            |||.||.|  ..||..|..::.|..:..:...::           |:.|||
Yeast   458 DATKAFSGGVYRHSNAAQNVLADMRVAVIKESKNSAIRMASKRGEIYETGK 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_001286018.1 Cyt-b5 46..116 CDD:395121 21/71 (30%)
OLE1NP_011460.3 OLE1 92..385 CDD:224316
CYB5 <408..510 CDD:227599 28/101 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.