DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and NIA1

DIOPT Version :10

Sequence 1:NP_609852.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_177899.1 Gene:NIA1 / 844112 AraportID:AT1G77760 Length:917 Species:Arabidopsis thaliana


Alignment Length:74 Identity:30/74 - (40%)
Similarity:49/74 - (66%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ALEEVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTGHSGDAIEMMK 109
            ::.||.:|::.|..|::::..:||.|.||:|||||.|.|:.:||.|.|..|... ||..|.::::
plant   549 SISEVRKHNTADSAWIIVHGHIYDCTRFLKDHPGGTDSILINAGTDCTEEFEAI-HSDKAKKLLE 612

  Fly   110 DFLIGQLPT 118
            |:.||:|.|
plant   613 DYRIGELIT 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_609852.1 Cyt-b5 46..116 CDD:459698 28/69 (41%)
NIA1NP_177899.1 PLN02252 1..917 CDD:215141 30/74 (41%)

Return to query results.
Submit another query.