powered by:
Protein Alignment CG6870 and CB5-A
DIOPT Version :9
Sequence 1: | NP_001286018.1 |
Gene: | CG6870 / 35067 |
FlyBaseID: | FBgn0032652 |
Length: | 137 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_173958.1 |
Gene: | CB5-A / 839176 |
AraportID: | AT1G26340 |
Length: | 135 |
Species: | Arabidopsis thaliana |
Alignment Length: | 72 |
Identity: | 38/72 - (52%) |
Similarity: | 53/72 - (73%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 ALEEVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTGHSGDAIEMMK 109
::||.|.|:..|||||||..:||||:.::.:|||||||::..||:|||..|...|||.||.|:|:
plant 9 SMEEAATHNKQDDCWVVIDGKVYDVSSYMDEHPGGDDVLLAVAGKDATDDFEDAGHSKDARELME 73
Fly 110 DFLIGQL 116
.:.||:|
plant 74 KYFIGEL 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5274 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1566561at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
5 | 4.780 |
|
Return to query results.
Submit another query.