DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and CB5-E

DIOPT Version :9

Sequence 1:NP_001286018.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_200168.1 Gene:CB5-E / 835438 AraportID:AT5G53560 Length:134 Species:Arabidopsis thaliana


Alignment Length:77 Identity:35/77 - (45%)
Similarity:52/77 - (67%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DLPEIALEEVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTGHSGDA 104
            |...::.|||::|:...|||::|..:|||||.|:.||||||:|::...|:|||..|...|||..|
plant     4 DRKVLSFEEVSKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFEDVGHSDTA 68

  Fly   105 IEMMKDFLIGQL 116
            .:||..:.||::
plant    69 RDMMDKYFIGEI 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_001286018.1 Cyt-b5 46..116 CDD:395121 34/69 (49%)
CB5-ENP_200168.1 Cyt-b5 9..81 CDD:395121 34/72 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100589
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.680

Return to query results.
Submit another query.