DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and CB5-E

DIOPT Version :10

Sequence 1:NP_609852.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_200168.1 Gene:CB5-E / 835438 AraportID:AT5G53560 Length:134 Species:Arabidopsis thaliana


Alignment Length:77 Identity:35/77 - (45%)
Similarity:52/77 - (67%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DLPEIALEEVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTGHSGDA 104
            |...::.|||::|:...|||::|..:|||||.|:.||||||:|::...|:|||..|...|||..|
plant     4 DRKVLSFEEVSKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFEDVGHSDTA 68

  Fly   105 IEMMKDFLIGQL 116
            .:||..:.||::
plant    69 RDMMDKYFIGEI 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_609852.1 Cyt-b5 46..116 CDD:459698 34/69 (49%)
CB5-ENP_200168.1 Cyt-b5 9..81 CDD:459698 34/72 (47%)

Return to query results.
Submit another query.