DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and CB5-C

DIOPT Version :10

Sequence 1:NP_609852.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_182188.1 Gene:CB5-C / 819277 AraportID:AT2G46650 Length:132 Species:Arabidopsis thaliana


Alignment Length:85 Identity:35/85 - (41%)
Similarity:57/85 - (67%) Gaps:6/85 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 IALEEVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTGHSGDAIEMM 108
            |:..:||:|...:|||::|:.:|||::.|:.:|||||:|::...|:||:|.|....||.||.|:|
plant     5 ISFHDVAKHKCKNDCWILIHGKVYDISTFMDEHPGGDNVLLAVTGKDASIDFEDVNHSKDAKELM 69

  Fly   109 KDFLIGQLP------TKQHI 122
            |.:.||.:.      |:|:|
plant    70 KKYCIGDVDQSTVPVTQQYI 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_609852.1 Cyt-b5 46..116 CDD:459698 31/69 (45%)
CB5-CNP_182188.1 Cyt-b5 6..78 CDD:459698 31/71 (44%)

Return to query results.
Submit another query.