DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and CB5-B

DIOPT Version :9

Sequence 1:NP_001286018.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001323464.1 Gene:CB5-B / 817832 AraportID:AT2G32720 Length:134 Species:Arabidopsis thaliana


Alignment Length:96 Identity:36/96 - (37%)
Similarity:49/96 - (51%) Gaps:17/96 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 CWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTGHSGDAIEMMKDFLIGQL------ 116
            ||.....:||:||.||.||||||||::...|:|||..|...|||..|.|||:.:.:|::      
plant    22 CWYSNLFQVYNVTKFLEDHPGGDDVLLSSTGKDATDDFEDVGHSESAREMMEQYYVGEIDPTTIP 86

  Fly   117 ------PTKQHIFRTGKN-----KVLSLGIP 136
                  |.||..:...|.     |:|...:|
plant    87 KKVKYTPPKQPHYNQDKTSEFIIKLLQFLVP 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_001286018.1 Cyt-b5 46..116 CDD:395121 29/57 (51%)
CB5-BNP_001323464.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100589
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.