DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and CYB5B

DIOPT Version :9

Sequence 1:NP_001286018.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_085056.2 Gene:CYB5B / 80777 HGNCID:24374 Length:150 Species:Homo sapiens


Alignment Length:71 Identity:37/71 - (52%)
Similarity:53/71 - (74%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LEEVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTGHSGDAIEMMKD 110
            |||||:.:|..:.|:||:.||||||.||.:||||::|:::.||.||:.:|...|||.||.||:|.
Human    29 LEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQ 93

  Fly   111 FLIGQL 116
            :.||.:
Human    94 YYIGDI 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_001286018.1 Cyt-b5 46..116 CDD:395121 37/69 (54%)
CYB5BNP_085056.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Cyt-b5 28..100 CDD:365921 37/71 (52%)
MIP <123..148 CDD:350945
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100589
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.