powered by:
Protein Alignment CG6870 and cyb5d1
DIOPT Version :9
Sequence 1: | NP_001286018.1 |
Gene: | CG6870 / 35067 |
FlyBaseID: | FBgn0032652 |
Length: | 137 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001017684.1 |
Gene: | cyb5d1 / 795592 |
ZFINID: | ZDB-GENE-050417-173 |
Length: | 214 |
Species: | Danio rerio |
Alignment Length: | 47 |
Identity: | 18/47 - (38%) |
Similarity: | 28/47 - (59%) |
Gaps: | 6/47 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 EVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDV----IMDHAGRD 90
||:.|::.:|.||....:|||:|..|..:.| || |::.||:|
Zfish 11 EVSLHNTINDIWVSYLGKVYDLTPLLEAYKG--DVLLKPIIECAGKD 55
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG6870 | NP_001286018.1 |
Cyt-b5 |
46..116 |
CDD:395121 |
18/47 (38%) |
cyb5d1 | NP_001017684.1 |
Cyt-b5 |
6..>60 |
CDD:278597 |
18/47 (38%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5274 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.