DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and cyb5b

DIOPT Version :9

Sequence 1:NP_001286018.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001011009.2 Gene:cyb5b / 496418 XenbaseID:XB-GENE-1016087 Length:141 Species:Xenopus tropicalis


Alignment Length:83 Identity:36/83 - (43%)
Similarity:56/83 - (67%) Gaps:3/83 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KLEDLPEI---ALEEVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGT 98
            |..:.|::   .||:|.:.::..:.|:||:|||||:|.|:.:||||::|:.:.||.|||.:|...
 Frog     7 KQSEEPQVTLYTLEDVRKRNTAKEIWLVIHDRVYDITKFVEEHPGGEEVLFEQAGADATESFEDA 71

  Fly    99 GHSGDAIEMMKDFLIGQL 116
            |||.||.||:..:.||.|
 Frog    72 GHSIDAREMLNQYYIGDL 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_001286018.1 Cyt-b5 46..116 CDD:395121 33/69 (48%)
cyb5bNP_001011009.2 Cyt-b5 16..89 CDD:278597 33/72 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.