DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and cyb5b

DIOPT Version :9

Sequence 1:NP_001286018.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_998041.1 Gene:cyb5b / 405812 ZFINID:ZDB-GENE-040426-2614 Length:153 Species:Danio rerio


Alignment Length:86 Identity:35/86 - (40%)
Similarity:58/86 - (67%) Gaps:7/86 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 EEVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTGHSGDAIEMMKDF 111
            :||..|:...|.|::|:|:|||:|.|:.:||||::|:::.||.|||.:|...|||.||.||::.:
Zfish    33 KEVQVHNMGKDTWLIIHDKVYDITSFMEEHPGGEEVLLEQAGADATESFEDVGHSTDAREMLQQY 97

  Fly   112 LIGQL-------PTKQHIFRT 125
            .||:|       .:|:.::.|
Zfish    98 YIGELHMDDRKKESKKEVYIT 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_001286018.1 Cyt-b5 46..116 CDD:395121 32/68 (47%)
cyb5bNP_998041.1 Cyt-b5 29..102 CDD:278597 32/68 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100589
Panther 1 1.100 - - O PTHR19359
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.