DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and FADS1

DIOPT Version :9

Sequence 1:NP_001286018.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_037534.5 Gene:FADS1 / 3992 HGNCID:3574 Length:501 Species:Homo sapiens


Alignment Length:89 Identity:37/89 - (41%)
Similarity:53/89 - (59%) Gaps:5/89 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 EEVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDAT---IAFHGTGHSGDAIEMM 108
            :||||....::.|:||..:||:::.|.|.||||..||..:||:|||   :|||  .:.|...:.|
Human    80 DEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPFVAFH--INKGLVKKYM 142

  Fly   109 KDFLIGQLPTKQHIFRTGKNKVLS 132
            ...|||:|..:|..|...|||.|:
Human   143 NSLLIGELSPEQPSFEPTKNKELT 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_001286018.1 Cyt-b5 46..116 CDD:395121 30/71 (42%)
FADS1NP_037534.5 PRK07003 <3..>75 CDD:235906
PLN03199 74..496 CDD:178740 37/89 (42%)
Delta6-FADS-like 218..469 CDD:239583
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3843
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.