powered by:
Protein Alignment CG6870 and CG5157
DIOPT Version :9
Sequence 1: | NP_001286018.1 |
Gene: | CG6870 / 35067 |
FlyBaseID: | FBgn0032652 |
Length: | 137 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_648843.1 |
Gene: | CG5157 / 39771 |
FlyBaseID: | FBgn0036575 |
Length: | 119 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 33/73 - (45%) |
Similarity: | 50/73 - (68%) |
Gaps: | 2/73 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 LEEVAQHDSFD--DCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTGHSGDAIEMM 108
|.||||.:..: .||::|...|||||.||.:||||.:.::::.|:|||.||...|||.||.:.:
Fly 7 LSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYGGKDATKAFKQAGHSSDAEKDL 71
Fly 109 KDFLIGQL 116
|::.||::
Fly 72 KNYKIGEI 79
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5274 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1566561at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR19359 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.920 |
|
Return to query results.
Submit another query.