DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and Cyt-b5

DIOPT Version :10

Sequence 1:NP_609852.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster


Alignment Length:111 Identity:42/111 - (37%)
Similarity:65/111 - (58%) Gaps:13/111 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EDLPEIALEEVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTGHSGD 103
            |:.......|||:|::..|.|::|::.:||||.||.:||||::|:::.||:|||..|...|||.|
  Fly     4 EETKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSND 68

  Fly   104 AIEMMKDFLIGQL-------------PTKQHIFRTGKNKVLSLGIP 136
            |.:|||.:.||:|             ||.....:|.::.|.|..:|
  Fly    69 ARDMMKKYKIGELVESERTSVAQKSEPTWSTEQQTEESSVKSWLVP 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_609852.1 Cyt-b5 46..116 CDD:459698 34/69 (49%)
Cyt-b5NP_610294.1 Cyt-b5 10..82 CDD:459698 34/71 (48%)

Return to query results.
Submit another query.