DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and CG15429

DIOPT Version :9

Sequence 1:NP_001286018.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster


Alignment Length:108 Identity:35/108 - (32%)
Similarity:48/108 - (44%) Gaps:31/108 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PSKKERLKLEDLPEIALEEVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGD------DVIMDHAG 88
            |..|.|..|:|       ||..|:..|||||:|:..:||:|..|:|.  .|      |.::.|||
  Fly     4 PINKMRYYLKD-------EVVSHNKKDDCWVIIHRNIYDLTPMLKDR--FDNWNRTLDYLVAHAG 59

  Fly    89 RDATIAFHGTGHSGDAIEMMKDFLIGQLPTKQHIFRTGKNKVL 131
            :|.|..||..|.....|.          |:      ||:.:||
  Fly    60 KDLTHFFHENGEPRTEIS----------PS------TGRPRVL 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_001286018.1 Cyt-b5 46..116 CDD:395121 25/75 (33%)
CG15429NP_608823.2 Cyt-b5 10..>70 CDD:278597 25/68 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.