DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and CG3566

DIOPT Version :9

Sequence 1:NP_001286018.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_572304.5 Gene:CG3566 / 31562 FlyBaseID:FBgn0029854 Length:117 Species:Drosophila melanogaster


Alignment Length:74 Identity:39/74 - (52%)
Similarity:52/74 - (70%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EIALEEVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTGHSGDAIEM 107
            ||.|..|.:|:...|.||||.::|||||.|..:||||::.::|.||||||.||:..|||.:|.||
  Fly     4 EIRLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGRDATKAFNDVGHSSEAREM 68

  Fly   108 MKDFLIGQL 116
            :|.:.||.|
  Fly    69 LKKYYIGDL 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_001286018.1 Cyt-b5 46..116 CDD:395121 36/69 (52%)
CG3566NP_572304.5 Cyt-b5 4..77 CDD:278597 38/72 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442792
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115989at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100589
Panther 1 1.100 - - P PTHR19359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.