powered by:
Protein Alignment CG6870 and scs7
DIOPT Version :9
Sequence 1: | NP_001286018.1 |
Gene: | CG6870 / 35067 |
FlyBaseID: | FBgn0032652 |
Length: | 137 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_594423.1 |
Gene: | scs7 / 2542519 |
PomBaseID: | SPAC19G12.08 |
Length: | 347 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 71 |
Identity: | 15/71 - (21%) |
Similarity: | 32/71 - (45%) |
Gaps: | 6/71 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 DDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTG---HSGDAIEMMKDFLIGQLP 117
:.|.::.....||||::|..:....|::..:..::.....:.|. ||...:|::|. .::|
pombe 7 EKCVILSDGTEYDVTNYLVANKDAADLLRRYHRQEVADILNATSKSKHSEAVVEILKS---AKVP 68
Fly 118 TKQHIF 123
.|...|
pombe 69 LKNKEF 74
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R279 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.