DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6870 and scs7

DIOPT Version :9

Sequence 1:	NP_001286018.1	Gene:	CG6870 / 35067	FlyBaseID:	FBgn0032652	Length:	137	Species:	Drosophila melanogaster
Sequence 2:	NP_594423.1	Gene:	scs7 / 2542519	PomBaseID:	SPAC19G12.08	Length:	347	Species:	Schizosaccharomyces pombe

Alignment Length:	71	Identity:	15/71 - (21%)
Similarity:	32/71 - (45%)	Gaps:	6/71 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    56 DDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTG---HSGDAIEMMKDFLIGQLP 117
            :.|.::.....||||::|..:....|::..:..::.....:.|.   ||...:|::|.   .::|
pombe     7 EKCVILSDGTEYDVTNYLVANKDAADLLRRYHRQEVADILNATSKSKHSEAVVEILKS---AKVP 68

  Fly   118 TKQHIF 123
            .|...|
pombe    69 LKNKEF 74

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6870	NP_001286018.1	Cyt-b5	46..116	CDD:395121	12/62 (19%)
scs7	NP_594423.1	CYB5	1..184	CDD:227599	15/71 (21%)
		FA_hydroxylase	108..331	CDD:294712
		ERG3	<188..347	CDD:225546
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R279
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.030