powered by:
Protein Alignment CG6870 and SPBC29A10.16c
DIOPT Version :9
Sequence 1: | NP_001286018.1 |
Gene: | CG6870 / 35067 |
FlyBaseID: | FBgn0032652 |
Length: | 137 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_596061.1 |
Gene: | SPBC29A10.16c / 2540533 |
PomBaseID: | SPBC29A10.16c |
Length: | 124 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 70 |
Identity: | 32/70 - (45%) |
Similarity: | 51/70 - (72%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 EEVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTGHSGDAIEMMKDF 111
||:.:|::..|.::||..:||||::|..|||||.|:::|:||:|||.|:...|||..|.|::::.
pombe 9 EEIVEHNNSKDMYMVINGKVYDVSNFADDHPGGLDIMLDYAGQDATKAYQDIGHSIAADELLEEM 73
Fly 112 LIGQL 116
.||.|
pombe 74 YIGDL 78
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5274 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_100589 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR19359 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
5 | 4.770 |
|
Return to query results.
Submit another query.