DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and SPBC29A10.16c

DIOPT Version :9

Sequence 1:NP_001286018.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_596061.1 Gene:SPBC29A10.16c / 2540533 PomBaseID:SPBC29A10.16c Length:124 Species:Schizosaccharomyces pombe


Alignment Length:70 Identity:32/70 - (45%)
Similarity:51/70 - (72%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 EEVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTGHSGDAIEMMKDF 111
            ||:.:|::..|.::||..:||||::|..|||||.|:::|:||:|||.|:...|||..|.|::::.
pombe     9 EEIVEHNNSKDMYMVINGKVYDVSNFADDHPGGLDIMLDYAGQDATKAYQDIGHSIAADELLEEM 73

  Fly   112 LIGQL 116
            .||.|
pombe    74 YIGDL 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_001286018.1 Cyt-b5 46..116 CDD:395121 31/68 (46%)
SPBC29A10.16cNP_596061.1 CYB5 <2..124 CDD:227599 32/70 (46%)
Cyt-b5 5..78 CDD:278597 31/68 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100589
Panther 1 1.100 - - O PTHR19359
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.