DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and cytb-5.1

DIOPT Version :9

Sequence 1:NP_001286018.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_510335.2 Gene:cytb-5.1 / 181510 WormBaseID:WBGene00007848 Length:134 Species:Caenorhabditis elegans


Alignment Length:79 Identity:36/79 - (45%)
Similarity:56/79 - (70%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LEDLPEIALEEVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTGHSG 102
            :.||.:|.|:|:|:|::....|:||.::|:|||.||.:||||.:|:::.||.|.|.||...|||.
 Worm     1 MADLKQITLKEIAEHNTNKSAWLVIGNKVFDVTKFLDEHPGGCEVLLEQAGSDGTEAFEDVGHST 65

  Fly   103 DAIEMMKDFLIGQL 116
            ||..|..::|||::
 Worm    66 DARHMKDEYLIGEV 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_001286018.1 Cyt-b5 46..116 CDD:395121 33/69 (48%)
cytb-5.1NP_510335.2 Cyt-b5 8..80 CDD:365921 33/72 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100589
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.