DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and fath-1

DIOPT Version :9

Sequence 1:NP_001286018.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_492678.1 Gene:fath-1 / 172882 WormBaseID:WBGene00007707 Length:316 Species:Caenorhabditis elegans


Alignment Length:79 Identity:20/79 - (25%)
Similarity:30/79 - (37%) Gaps:11/79 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 YDVTHFLRDHPGGDDVIMDHAGRDATIAFHGT--------GHSGDAIEMMKDFLIGQLPTKQHIF 123
            ||:..|...||||..|:...||.:......|.        .||..|..|::.:.:..:.....:.
 Worm    20 YDIADFAPKHPGGAKVLNRLAGEEIGEFIRGEKRIMGVRHEHSEAAYNMLERYNVNAIQKGDPLI 84

  Fly   124 RTGKN---KVLSLG 134
            .:...   ||.|||
 Worm    85 ESKSGMLFKVGSLG 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_001286018.1 Cyt-b5 46..116 CDD:395121 15/56 (27%)
fath-1NP_492678.1 Cyt-b5 6..72 CDD:278597 15/51 (29%)
FA_hydroxylase 90..311 CDD:294712 5/9 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.