DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and cytb-5.2

DIOPT Version :9

Sequence 1:NP_001286018.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001379864.1 Gene:cytb-5.2 / 172393 WormBaseID:WBGene00020931 Length:141 Species:Caenorhabditis elegans


Alignment Length:83 Identity:44/83 - (53%)
Similarity:60/83 - (72%) Gaps:3/83 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LEDLPEIALEEVAQH---DSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTG 99
            :.:|..|:|:||::|   |:...||:||..:|||||.||.:||||::||...||:|||:.|...|
 Worm     1 MSELRVISLDEVSKHNWEDADQSCWIVISGKVYDVTKFLNEHPGGEEVITQLAGKDATVGFLDVG 65

  Fly   100 HSGDAIEMMKDFLIGQLP 117
            ||.|||||..::||||||
 Worm    66 HSKDAIEMANEYLIGQLP 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_001286018.1 Cyt-b5 46..116 CDD:395121 39/72 (54%)
cytb-5.2NP_001379864.1 Cyt-b5 8..82 CDD:395121 39/73 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166651
Domainoid 1 1.000 88 1.000 Domainoid score I5083
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100589
Panther 1 1.100 - - LDO PTHR19359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.