DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6870 and cytb-5.2

DIOPT Version :10

Sequence 1:NP_609852.1 Gene:CG6870 / 35067 FlyBaseID:FBgn0032652 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001379864.1 Gene:cytb-5.2 / 172393 WormBaseID:WBGene00020931 Length:141 Species:Caenorhabditis elegans


Alignment Length:83 Identity:44/83 - (53%)
Similarity:60/83 - (72%) Gaps:3/83 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LEDLPEIALEEVAQH---DSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTG 99
            :.:|..|:|:||::|   |:...||:||..:|||||.||.:||||::||...||:|||:.|...|
 Worm     1 MSELRVISLDEVSKHNWEDADQSCWIVISGKVYDVTKFLNEHPGGEEVITQLAGKDATVGFLDVG 65

  Fly   100 HSGDAIEMMKDFLIGQLP 117
            ||.|||||..::||||||
 Worm    66 HSKDAIEMANEYLIGQLP 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6870NP_609852.1 Cyt-b5 46..116 CDD:459698 39/72 (54%)
cytb-5.2NP_001379864.1 Cyt-b5 8..82 CDD:459698 39/73 (53%)

Return to query results.
Submit another query.