Sequence 1: | NP_001286018.1 | Gene: | CG6870 / 35067 | FlyBaseID: | FBgn0032652 | Length: | 137 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_653208.2 | Gene: | CYB5D1 / 124637 | HGNCID: | 26516 | Length: | 228 | Species: | Homo sapiens |
Alignment Length: | 45 | Identity: | 18/45 - (40%) |
---|---|---|---|
Similarity: | 27/45 - (60%) | Gaps: | 2/45 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 EVAQHDSFDDCWVVIYDRVYDVTHFLRDHPGG--DDVIMDHAGRD 90 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6870 | NP_001286018.1 | Cyt-b5 | 46..116 | CDD:395121 | 18/45 (40%) |
CYB5D1 | NP_653208.2 | Cyt-b5 | 21..>70 | CDD:306642 | 18/45 (40%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5274 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |