DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and Olig3

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_443734.2 Gene:Olig3 / 94222 MGIID:2149955 Length:273 Species:Mus musculus


Alignment Length:169 Identity:64/169 - (37%)
Similarity:87/169 - (51%) Gaps:46/169 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 AVSSGGASGSGSNS----GKQKNRQG-KTVRLNINARERRRMHDLNDALDELRSVIPYAHSPSVR 164
            ::|..||..:|.:|    .||.:.|. :.:||.||.|||:||||||.|:|.||.|:||||.||||
Mouse    56 SLSRAGAKAAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVR 120

  Fly   165 KLSKIATLLLAKNYILMQQNALEELRRLLAYI--------------------------------- 196
            |||||||||||:|||||..::|||::||:..|                                 
Mouse   121 KLSKIATLLLARNYILMLTSSLEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANAVHPVHPI 185

  Fly   197 -----QSTTGAAPLDLGAFPAAAKLQ---ALLQGPHNEP 227
                 .|...::||...:.|....::   :||:.|...|
Mouse   186 LGGALSSGNASSPLSATSLPTIGTIRPPHSLLKAPSTPP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 40/53 (75%)
Olig3NP_443734.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..72 5/15 (33%)
HLH 86..139 CDD:306515 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.