DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oli and Twist1

DIOPT Version :9

Sequence 1:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_445982.1 Gene:Twist1 / 85489 RGDID:621455 Length:203 Species:Rattus norvegicus


Alignment Length:193 Identity:59/193 - (30%)
Similarity:80/193 - (41%) Gaps:38/193 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PIPPTANMLGGQHPAPTASPPQS--------VPGRRTPLGSVGLGGFYAQGMGMSQQPPTDENKP 76
            |:.|..:.|......|....|.|        ...||:..||.|.||....|:|       ..::|
  Rat     9 PVSPADDSLSNSEEEPDRQQPASGKRGARKRRSSRRSAGGSAGPGGATGGGIG-------GGDEP 66

  Fly    77 GPSAPEKPLSPTAAAIAAIAISGGTTTVAVSSGGASGSGSNSG---KQKNRQGKTVRLNINARER 138
            |..|..|....:|..      .||      :.||..|.||:||   .|...:.:|.|:..|.|||
  Rat    67 GSPAQGKRGKKSAGG------GGG------AGGGGGGGGSSSGGGSPQSYEELQTQRVMANVRER 119

  Fly   139 RRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYI-----LMQQNALEELRRLLAYI 196
            :|...||:|...||.:||...|.   |||||.||.||..||     ::|.:.|:......:|:
  Rat   120 QRTQSLNEAFAALRKIIPTLPSD---KLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYV 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OliNP_001188830.1 HLH 134..188 CDD:197674 26/58 (45%)
Twist1NP_445982.1 HLH 110..160 CDD:278439 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.